SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96J92

- WNK4_HUMAN

UniProt

Q96J92 - WNK4_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Serine/threonine-protein kinase WNK4

Gene
WNK4, PRKWNK4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Serine/threonine kinase which plays an important role in the regulation of electrolyte homeostasis, cell signaling, survival and proliferation. Acts as an activator and inhibitor of sodium-coupled chloride cotransporters and potassium-coupled chloride cotransporters respectively. Activates SCNN1A, SCNN1B, SCNN1D, SGK1, TRPV5 and TRPV6. Regulates the activity of the thiazide-sensitive Na-Cl cotransporter, SLC12A3, by phosphorylation which appears to prevent membrane trafficking of SLC12A3. Also inhibits the renal K+ channel, KCNJ1, via a kinase-independent mechanism by which it induces clearance of the protein from the cell surface by clathrin-dependent endocytosis. WNK4 appears to act as a molecular switch that can vary the balance between NaCl reabsorption and K+ secretion to maintain integrated homeostasis. Phosphorylates NEDD4L.1 Publication

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Magnesium By similarity.By similarity

Enzyme regulationi

Activation requires autophosphorylation of Ser-335. Phosphorylation of Ser-331 also promotes increased activity By similarity.By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei186 – 1861ATP By similarityBy similarity
Active sitei302 – 3021Proton acceptor By similarityBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi180 – 1889ATP By similarityBy similarity

GO - Molecular functioni

  1. ATP binding Source: UniProtKB
  2. chloride channel inhibitor activity Source: UniProt
  3. protein binding Source: UniProtKB
  4. protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

  1. chloride transport Source: Ensembl
  2. distal tubule morphogenesis Source: UniProtKB
  3. intracellular signal transduction Source: UniProtKB
  4. ion homeostasis Source: UniProtKB
  5. ion transport Source: UniProtKB
  6. negative regulation of pancreatic juice secretion Source: Ensembl
  7. protein localization Source: Ensembl
  8. protein phosphorylation Source: UniProtKB
  9. regulation of cellular process Source: UniProtKB
  10. renal sodium ion absorption Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiREACT_160189. Stimuli-sensing channels.
SignaLinkiQ96J92.

Names & Taxonomyi

Protein namesi
Recommended name:
Serine/threonine-protein kinase WNK4 (EC:2.7.11.1)
Alternative name(s):
Protein kinase lysine-deficient 4
Protein kinase with no lysine 4
Gene namesi
Name:WNK4
Synonyms:PRKWNK4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:14544. WNK4.

Subcellular locationi

Cell junctiontight junction By similarity
Note: Present exclusively in intercellular junctions in the distal convoluted tubule and in both the cytoplasm and intercellular junctions in the cortical collecting duct. WNK4 is part of the tight junction complex By similarity.

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. tight junction Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Tight junction

Pathology & Biotechi

Involvement in diseasei

Pseudohypoaldosteronism 2B (PHA2B) [MIM:614491]: An autosomal dominant disorder characterized by hypertension, hyperkalemia, hyperchloremia, mild hyperchloremic metabolic acidosis, and correction of physiologic abnormalities by thiazide diuretics.
Note: The disease is caused by mutations affecting the gene represented in this entry.4 Publications
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti562 – 5621E → K in PHA2B; impaired interaction with KLHL3. 3 Publications
VAR_017588
Natural varianti564 – 5641D → A in PHA2B; impaired interaction with KLHL3. 2 Publications
VAR_017589
Natural varianti565 – 5651Q → E in PHA2B; impaired interaction with KLHL3. 3 Publications
VAR_017590
Natural varianti1185 – 11851R → C in PHA2B. 1 Publication
VAR_017591

Keywords - Diseasei

Disease mutation

Organism-specific databases

MIMi614491. phenotype.
Orphaneti88939. Pseudohypoaldosteronism type 2B.
PharmGKBiPA134875400.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 12431243Serine/threonine-protein kinase WNK4PRO_0000086824Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki157 – 157Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki175 – 175Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki186 – 186Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki226 – 226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki241 – 241Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki328 – 328Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Modified residuei331 – 3311Phosphoserine; by autocatalysis By similarityBy similarity
Modified residuei335 – 3351Phosphoserine; by autocatalysis By similarityBy similarity
Cross-linki387 – 387Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki393 – 393Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki450 – 450Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki454 – 454Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki1010 – 1010Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki1144 – 1144Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki1157 – 1157Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication
Cross-linki1158 – 1158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Post-translational modificationi

Phosphorylated by WNK1 and WNK3 By similarity.
Ubiquitinated by the BCR(KLHL3) complex, leading to its degradation and increased expression of KCNJ1 at the cell surface. Ubiquitinated by the BCR(KLHL2) complex.3 Publications

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ96J92.
PaxDbiQ96J92.
PRIDEiQ96J92.

PTM databases

PhosphoSiteiQ96J92.

Expressioni

Tissue specificityi

Expressed in kidney, colon and skin.1 Publication

Gene expression databases

ArrayExpressiQ96J92.
BgeeiQ96J92.
CleanExiHS_WNK4.
GenevestigatoriQ96J92.

Organism-specific databases

HPAiHPA016500.

Interactioni

Subunit structurei

Interacts with the C-terminal region of KCNJ1 By similarity. Interacts with WNK1 and WNK3 By similarity. Interacts with KLHL3.By similarity4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
OXSR1O9574711EBI-766352,EBI-620853

Protein-protein interaction databases

BioGridi122421. 12 interactions.
IntActiQ96J92. 6 interactions.
MINTiMINT-5207492.
STRINGi9606.ENSP00000246914.

Structurei

Secondary structure

1
1243
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi562 – 5643

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2V3SX-ray1.70C/D1015-1020[»]
4CH9X-ray1.84C/D557-567[»]
4CHBX-ray1.56C/D557-567[»]
ProteinModelPortaliQ96J92.
SMRiQ96J92. Positions 132-523.

Miscellaneous databases

EvolutionaryTraceiQ96J92.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini174 – 432259Protein kinaseAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0515.
HOGENOMiHOG000230962.
HOVERGENiHBG050347.
InParanoidiQ96J92.
KOiK08867.
OMAiESHLRLP.
OrthoDBiEOG7KDF8Z.
PhylomeDBiQ96J92.
TreeFamiTF315363.

Family and domain databases

InterProiIPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PfamiPF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 2 hits.
PROSITEiPS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q96J92-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MLASPATETT VLMSQTEADL ALRPPPPLGT AGQPRLGPPP RRARRFSGKA     50
EPRPRSSRLS RRSSVDLGLL SSWSLPASPA PDPPDPPDSA GPGPARSPPP 100
SSKEPPEGTW TEGAPVKAAE DSARPELPDS AVGPGSREPL RVPEAVALER 150
RREQEEKEDM ETQAVATSPD GRYLKFDIEI GRGSFKTVYR GLDTDTTVEV 200
AWCELQTRKL SRAERQRFSE EVEMLKGLQH PNIVRFYDSW KSVLRGQVCI 250
VLVTELMTSG TLKTYLRRFR EMKPRVLQRW SRQILRGLHF LHSRVPPILH 300
RDLKCDNVFI TGPTGSVKIG DLGLATLKRA SFAKSVIGTP EFMAPEMYEE 350
KYDEAVDVYA FGMCMLEMAT SEYPYSECQN AAQIYRKVTS GRKPNSFHKV 400
KIPEVKEIIE GCIRTDKNER FTIQDLLAHA FFREERGVHV ELAEEDDGEK 450
PGLKLWLRME DARRGGRPRD NQAIEFLFQL GRDAAEEVAQ EMVALGLVCE 500
ADYQPVARAV RERVAAIQRK REKLRKAREL EALPPEPGPP PATVPMAPGP 550
PSVFPPEPEE PEADQHQPFL FRHASYSSTT SDCETDGYLS SSGFLDASDP 600
ALQPPGGVPS SLAESHLCLP SAFALSIPRS GPGSDFSPGD SYASDAASGL 650
SDVGEGMGQM RRPPGRNLRR RPRSRLRVTS VSDQNDRVVE CQLQTHNSKM 700
VTFRFDLDGD SPEEIAAAMV YNEFILPSER DGFLRRIREI IQRVETLLKR 750
DTGPMEAAED TLSPQEEPAP LPALPVPLPD PSNEELQSST SLEHRSWTAF 800
STSSSSPGTP LSPGNPFSPG TPISPGPIFP ITSPPCHPSP SPFSPISSQV 850
SSNPSPHPTS SPLPFSSSTP EFPVPLSQCP WSSLPTTSPP TFSPTCSQVT 900
LSSPFFPPCP STSSFPSTTA APLLSLASAF SLAVMTVAQS LLSPSPGLLS 950
QSPPAPPSPL PSLPLPPPVA PGGQESPSPH TAEVESEASP PPARPLPGEA 1000
RLAPISEEGK PQLVGRFQVT SSKEPAEPLP LQPTSPTLSG SPKPSTPQLT 1050
SESSDTEDSA GGGPETREAL AESDRAAEGL GAGVEEEGDD GKEPQVGGSP 1100
QPLSHPSPVW MNYSYSSLCL SSEESESSGE DEEFWAELQS LRQKHLSEVE 1150
TLQTLQKKEI EDLYSRLGKQ PPPGIVAPAA MLSSRQRRLS KGSFPTSRRN 1200
SLQRSEPPGP GIMRRNSLSG SSTGSQEQRA SKGVTFAGDV GRM 1243
Length:1,243
Mass (Da):134,739
Last modified:December 1, 2001 - v1
Checksum:iBAC35F0098BA3391
GO
Isoform 2 (identifier: Q96J92-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-228: Missing.
     229-264: QHPNIVRFYDSWKSVLRGQVCIVLVTELMTSGTLKT → MRRRQQGAAGGNFPVGGSFPEDVSPHQDSGYAPSPR
     828-1210: Missing.
     1233-1243: GVTFAGDVGRM → EAGQRPGKLWLRATVQLRVWGLELRRKEMMGRNPKLGAAPNP

Note: No experimental confirmation available.

Show »
Length:663
Mass (Da):73,370
Checksum:i6711A9D6CEFD8146
GO
Isoform 3 (identifier: Q96J92-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1145-1165: HLSEVETLQTLQKKEIEDLYS → PFHALRASSGTCQRWKHYRHY
     1166-1243: Missing.

Note: No experimental confirmation available. Incomplete sequence.

Show »
Length:1,165
Mass (Da):126,577
Checksum:i87D926F2D3141A1B
GO

Sequence cautioni

The sequence CAC48387.1 differs from that shown. Reason: Frameshift at position 4.
The sequence BAC04669.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti434 – 4341E → D in an ovarian mucinous carcinoma sample; somatic mutation. 1 Publication
VAR_041330
Natural varianti562 – 5621E → K in PHA2B; impaired interaction with KLHL3. 3 Publications
VAR_017588
Natural varianti564 – 5641D → A in PHA2B; impaired interaction with KLHL3. 2 Publications
VAR_017589
Natural varianti565 – 5651Q → E in PHA2B; impaired interaction with KLHL3. 3 Publications
VAR_017590
Natural varianti601 – 6011A → S.
Corresponds to variant rs55781437 [ dbSNP | Ensembl ].
VAR_061748
Natural varianti677 – 6771R → W.
Corresponds to variant rs9896991 [ dbSNP | Ensembl ].
VAR_051685
Natural varianti813 – 8131P → L.1 Publication
VAR_041331
Natural varianti961 – 9611P → S.
Corresponds to variant rs2290041 [ dbSNP | Ensembl ].
VAR_051686
Natural varianti992 – 9921P → S in a metastatic melanoma sample; somatic mutation. 1 Publication
VAR_041332
Natural varianti1013 – 10131L → P.1 Publication
VAR_041333
Natural varianti1185 – 11851R → C in PHA2B. 1 Publication
VAR_017591

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 228228Missing in isoform 2. VSP_050648Add
BLAST
Alternative sequencei229 – 26436QHPNI…GTLKT → MRRRQQGAAGGNFPVGGSFP EDVSPHQDSGYAPSPR in isoform 2. VSP_050649Add
BLAST
Alternative sequencei828 – 1210383Missing in isoform 2. VSP_050650Add
BLAST
Alternative sequencei1145 – 116521HLSEV…EDLYS → PFHALRASSGTCQRWKHYRH Y in isoform 3. VSP_050652Add
BLAST
Alternative sequencei1166 – 124378Missing in isoform 3. VSP_050653Add
BLAST
Alternative sequencei1233 – 124311GVTFAGDVGRM → EAGQRPGKLWLRATVQLRVW GLELRRKEMMGRNPKLGAAP NP in isoform 2. VSP_050651Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti525 – 5251R → C in BAC04688. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF390018 mRNA. Translation: AAK91995.1.
AJ316534 mRNA. Translation: CAC48387.1. Frameshift.
AK096003 mRNA. Translation: BAC04669.1. Different initiation.
AK096052 mRNA. Translation: BAC04688.1.
EU332870 Genomic DNA. Translation: ABY87559.1.
CH471152 Genomic DNA. Translation: EAW60881.1.
CH471152 Genomic DNA. Translation: EAW60882.1.
BC136664 mRNA. Translation: AAI36665.1.
AJ309861 mRNA. Translation: CAC32991.1.
CCDSiCCDS11439.1. [Q96J92-1]
RefSeqiNP_115763.2. NM_032387.4. [Q96J92-1]
UniGeneiHs.105448.

Genome annotation databases

EnsembliENST00000246914; ENSP00000246914; ENSG00000126562. [Q96J92-1]
GeneIDi65266.
KEGGihsa:65266.
UCSCiuc002ibj.3. human. [Q96J92-1]

Polymorphism databases

DMDMi41688789.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF390018 mRNA. Translation: AAK91995.1 .
AJ316534 mRNA. Translation: CAC48387.1 . Frameshift.
AK096003 mRNA. Translation: BAC04669.1 . Different initiation.
AK096052 mRNA. Translation: BAC04688.1 .
EU332870 Genomic DNA. Translation: ABY87559.1 .
CH471152 Genomic DNA. Translation: EAW60881.1 .
CH471152 Genomic DNA. Translation: EAW60882.1 .
BC136664 mRNA. Translation: AAI36665.1 .
AJ309861 mRNA. Translation: CAC32991.1 .
CCDSi CCDS11439.1. [Q96J92-1 ]
RefSeqi NP_115763.2. NM_032387.4. [Q96J92-1 ]
UniGenei Hs.105448.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2V3S X-ray 1.70 C/D 1015-1020 [» ]
4CH9 X-ray 1.84 C/D 557-567 [» ]
4CHB X-ray 1.56 C/D 557-567 [» ]
ProteinModelPortali Q96J92.
SMRi Q96J92. Positions 132-523.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122421. 12 interactions.
IntActi Q96J92. 6 interactions.
MINTi MINT-5207492.
STRINGi 9606.ENSP00000246914.

Chemistry

ChEMBLi CHEMBL1795196.

PTM databases

PhosphoSitei Q96J92.

Polymorphism databases

DMDMi 41688789.

Proteomic databases

MaxQBi Q96J92.
PaxDbi Q96J92.
PRIDEi Q96J92.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000246914 ; ENSP00000246914 ; ENSG00000126562 . [Q96J92-1 ]
GeneIDi 65266.
KEGGi hsa:65266.
UCSCi uc002ibj.3. human. [Q96J92-1 ]

Organism-specific databases

CTDi 65266.
GeneCardsi GC17P040932.
GeneReviewsi WNK4.
HGNCi HGNC:14544. WNK4.
HPAi HPA016500.
MIMi 601844. gene.
614491. phenotype.
neXtProti NX_Q96J92.
Orphaneti 88939. Pseudohypoaldosteronism type 2B.
PharmGKBi PA134875400.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0515.
HOGENOMi HOG000230962.
HOVERGENi HBG050347.
InParanoidi Q96J92.
KOi K08867.
OMAi ESHLRLP.
OrthoDBi EOG7KDF8Z.
PhylomeDBi Q96J92.
TreeFami TF315363.

Enzyme and pathway databases

Reactomei REACT_160189. Stimuli-sensing channels.
SignaLinki Q96J92.

Miscellaneous databases

ChiTaRSi WNK4. human.
EvolutionaryTracei Q96J92.
GeneWikii WNK4.
GenomeRNAii 65266.
NextBioi 67398.
PROi Q96J92.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96J92.
Bgeei Q96J92.
CleanExi HS_WNK4.
Genevestigatori Q96J92.

Family and domain databases

InterProi IPR011009. Kinase-like_dom.
IPR024678. Kinase_OSR1/WNK_CCT.
IPR000719. Prot_kinase_dom.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view ]
Pfami PF12202. OSR1_C. 1 hit.
PF00069. Pkinase. 1 hit.
[Graphical view ]
SUPFAMi SSF56112. SSF56112. 2 hits.
PROSITEi PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), DISEASE, VARIANTS PHA2B LYS-562; ALA-564; GLU-565 AND CYS-1185.
    Tissue: Kidney.
  2. Chistiakov D.A.
    Thesis (2001), College de France / Paris, France
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 504-1165 (ISOFORM 3).
    Tissue: Kidney.
  4. NHLBI resequencing and genotyping service (RS&G)
    Submitted (DEC-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
  7. "WNK kinases, a novel protein kinase subfamily in multi-cellular organisms."
    Verissimo F., Jordan P.
    Oncogene 20:5562-5569(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 207-418 (ISOFORMS 1/3), TISSUE SPECIFICITY, CHROMOSOMAL LOCATION.
    Tissue: Colon.
  8. "Serum and glucocorticoid-induced kinase (SGK) 1 and the epithelial sodium channel are regulated by multiple with no lysine (WNK) family members."
    Heise C.J., Xu B.E., Deaton S.L., Cha S.K., Cheng C.J., Earnest S., Sengupta S., Juang Y.C., Stippec S., Xu Y., Zhao Y., Huang C.L., Cobb M.H.
    J. Biol. Chem. 285:25161-25167(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  9. Cited for: UBIQUITINATION BY KLHL2.
  10. "The CUL3-KLHL3 E3 ligase complex mutated in Gordon's hypertension syndrome interacts with and ubiquitylates WNK isoforms: disease-causing mutations in KLHL3 and WNK4 disrupt interaction."
    Ohta A., Schumacher F.R., Mehellou Y., Johnson C., Knebel A., Macartney T.J., Wood N.T., Alessi D.R., Kurz T.
    Biochem. J. 451:111-122(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KLHL3, CHARACTERIZATION OF VARIANTS PHA2B LYS-562 AND GLU-565.
  11. Cited for: UBIQUITINATION, INTERACTION WITH KLHL3, CHARACTERIZATION OF VARIANT PHA2B ALA-564.
  12. "Disease-causing mutations in KLHL3 impair its effect on WNK4 degradation."
    Wu G., Peng J.B.
    FEBS Lett. 587:1717-1722(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH KLHL3.
  13. "Kelch-like 3 and Cullin 3 regulate electrolyte homeostasis via ubiquitination and degradation of WNK4."
    Shibata S., Zhang J., Puthumana J., Stone K.L., Lifton R.P.
    Proc. Natl. Acad. Sci. U.S.A. 110:7838-7843(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION AT LYS-157; LYS-175; LYS-186; LYS-226; LYS-241; LYS-328; LYS-387; LYS-393; LYS-450; LYS-454; LYS-1010; LYS-1144; LYS-1157 AND LYS-1158, INTERACTION WITH KLHL3, CHARACTERIZATION OF VARIANTS PHA2B LYS-562 AND GLU-565.
  14. "Patterns of somatic mutation in human cancer genomes."
    Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G.
    , Choudhury B., Clements J., Cole J., Dicks E., Forbes S., Gray K., Halliday K., Harrison R., Hills K., Hinton J., Jenkinson A., Jones D., Menzies A., Mironenko T., Perry J., Raine K., Richardson D., Shepherd R., Small A., Tofts C., Varian J., Webb T., West S., Widaa S., Yates A., Cahill D.P., Louis D.N., Goldstraw P., Nicholson A.G., Brasseur F., Looijenga L., Weber B.L., Chiew Y.-E., DeFazio A., Greaves M.F., Green A.R., Campbell P., Birney E., Easton D.F., Chenevix-Trench G., Tan M.-H., Khoo S.K., Teh B.T., Yuen S.T., Leung S.Y., Wooster R., Futreal P.A., Stratton M.R.
    Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS [LARGE SCALE ANALYSIS] ASP-434; LEU-813; SER-992 AND PRO-1013.

Entry informationi

Entry nameiWNK4_HUMAN
AccessioniPrimary (citable) accession number: Q96J92
Secondary accession number(s): B0LPI0
, Q8N8X3, Q8N8Z2, Q96DT8, Q9BYS5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 2, 2004
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 129 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi