Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96IZ2 (ADTRP_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Androgen-dependent TFPI-regulating protein
Gene names
Name:ADTRP
Synonyms:C6orf105
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length230 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro). Ref.5

Subcellular location

Cell membrane; Multi-pass membrane protein. Note: Colocalized with TFPI and CAV1 in lipid rafts. Ref.5

Tissue specificity

Expressed in cultured endothelial cells and in placenta. Ref.5

Induction

By androgens. Ref.5

Sequence similarities

Belongs to the AIG1 family.

Ontologies

Keywords
   Cellular componentCell membrane
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96IZ2-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96IZ2-2)

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL
Isoform 3 (identifier: Q96IZ2-3)

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 230230Androgen-dependent TFPI-regulating protein
PRO_0000190100

Regions

Transmembrane4 – 2421Helical; Potential
Transmembrane47 – 6721Helical; Potential
Transmembrane86 – 10621Helical; Potential
Transmembrane120 – 14021Helical; Potential
Transmembrane155 – 17521Helical; Potential
Transmembrane190 – 21021Helical; Potential

Natural variations

Alternative sequence521L → LKNRTAGFDIYQPGSFRQL in isoform 2.
VSP_041965
Alternative sequence220 – 23011GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3.
VSP_042868
Natural variant2021V → I.
Corresponds to variant rs2076185 [ dbSNP | Ensembl ].
VAR_024365

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 49B964B41C381360

FASTA23026,842
        10         20         30         40         50         60 
MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN LLLQTIFYGV 

        70         80         90        100        110        120 
TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL AFWILFLYNR DLIYPKVLDT 

       130        140        150        160        170        180 
VIPVWLNHAM HTFIFPITLA EVVLRPHSYP SKKTGLTLLA AASIAYISRI LWLYFETGTW 

       190        200        210        220        230 
VYPVFAKLSL LGLAAFFSLS YVFIASIYLL GEKLNHWKWG DMRQPRKKRK 

« Hide

Isoform 2 [UniParc].

Checksum: 88183242A57FD4AF
Show »

FASTA24828,922
Isoform 3 [UniParc].

Checksum: 934C3EDDD32B17FF
Show »

FASTA25529,789

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Colon and Small intestine.
[2]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Bone marrow.
[5]"Novel protein ADTRP regulates TFPI expression and function in human endothelial cells in normal conditions and in response to androgen."
Lupu C., Zhu H., Popescu N.I., Wren J.D., Lupu F.
Blood 118:4463-4471(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.1. [Q96IZ2-1]
UniGeneHs.126409.

3D structure databases

ProteinModelPortalQ96IZ2.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124285. 1 interaction.
IntActQ96IZ2. 3 interactions.
STRING9606.ENSP00000404416.

PTM databases

PhosphoSiteQ96IZ2.

Polymorphism databases

DMDM83286865.

Proteomic databases

PRIDEQ96IZ2.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000379413; ENSP00000368723; ENSG00000111863. [Q96IZ2-3]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneID84830.
KEGGhsa:84830.
UCSCuc003nab.3. human. [Q96IZ2-1]
uc011dip.2. human. [Q96IZ2-2]

Organism-specific databases

CTD84830.
GeneCardsGC06M011712.
HGNCHGNC:21214. ADTRP.
HPAHPA048113.
MIM614348. gene.
neXtProtNX_Q96IZ2.
PharmGKBPA134981312.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG267917.
HOGENOMHOG000006895.
HOVERGENHBG050468.
OMANHAMHTS.
PhylomeDBQ96IZ2.
TreeFamTF318170.

Gene expression databases

ArrayExpressQ96IZ2.
BgeeQ96IZ2.
CleanExHS_C6orf105.
GenevestigatorQ96IZ2.

Family and domain databases

InterProIPR006838. Far-17a_AIG1.
[Graphical view]
PfamPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi84830.
NextBio75041.
PROQ96IZ2.
SOURCESearch...

Entry information

Entry nameADTRP_HUMAN
AccessionPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
Entry history
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM