Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Androgen-dependent TFPI-regulating protein

Gene

ADTRP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).1 Publication

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111863-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Androgen-dependent TFPI-regulating protein
Gene namesi
Name:ADTRP
Synonyms:C6orf105
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21214. ADTRP.

Subcellular locationi

  • Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication

  • Note: Colocalized with TFPI and CAV1 in lipid rafts.

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Transmembranei47 – 67HelicalSequence analysisAdd BLAST21
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Transmembranei190 – 210HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi84830.
OpenTargetsiENSG00000111863.
PharmGKBiPA134981312.

Polymorphism and mutation databases

BioMutaiADTRP.
DMDMi83286865.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001901001 – 230Androgen-dependent TFPI-regulating proteinAdd BLAST230

Proteomic databases

PeptideAtlasiQ96IZ2.
PRIDEiQ96IZ2.

PTM databases

iPTMnetiQ96IZ2.
PhosphoSitePlusiQ96IZ2.

Expressioni

Tissue specificityi

Expressed in cultured endothelial cells and in placenta.1 Publication

Inductioni

By androgens.1 Publication

Gene expression databases

BgeeiENSG00000111863.
CleanExiHS_C6orf105.
ExpressionAtlasiQ96IZ2. baseline and differential.
GenevisibleiQ96IZ2. HS.

Organism-specific databases

HPAiHPA048113.

Interactioni

Protein-protein interaction databases

BioGridi124285. 3 interactors.
IntActiQ96IZ2. 3 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ96IZ2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AIG1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000012526.
HOGENOMiHOG000006895.
HOVERGENiHBG050468.
InParanoidiQ96IZ2.
OMAiHNYPSKK.
OrthoDBiEOG091G0LUO.
PhylomeDBiQ96IZ2.
TreeFamiTF318170.

Family and domain databases

InterProiIPR006838. Far-17a_AIG1.
[Graphical view]
PfamiPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN
60 70 80 90 100
LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL
110 120 130 140 150
AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP
160 170 180 190 200
SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS
210 220 230
YVFIASIYLL GEKLNHWKWG DMRQPRKKRK
Length:230
Mass (Da):26,842
Last modified:December 1, 2001 - v1
Checksum:i49B964B41C381360
GO
Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL

Show »
Length:248
Mass (Da):28,922
Checksum:i88183242A57FD4AF
GO
Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):29,789
Checksum:i934C3EDDD32B17FF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024365202V → I.Corresponds to variant rs2076185dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04196552L → LKNRTAGFDIYQPGSFRQL in isoform 2. 1 Publication1
Alternative sequenceiVSP_042868220 – 230GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. CuratedAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSiCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.3. [Q96IZ2-1]
XP_011513258.1. XM_011514956.1. [Q96IZ2-3]
UniGeneiHs.126409.

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneIDi84830.
KEGGihsa:84830.
UCSCiuc003nab.4. human. [Q96IZ2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSiCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.3. [Q96IZ2-1]
XP_011513258.1. XM_011514956.1. [Q96IZ2-3]
UniGeneiHs.126409.

3D structure databases

ProteinModelPortaliQ96IZ2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124285. 3 interactors.
IntActiQ96IZ2. 3 interactors.

PTM databases

iPTMnetiQ96IZ2.
PhosphoSitePlusiQ96IZ2.

Polymorphism and mutation databases

BioMutaiADTRP.
DMDMi83286865.

Proteomic databases

PeptideAtlasiQ96IZ2.
PRIDEiQ96IZ2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneIDi84830.
KEGGihsa:84830.
UCSCiuc003nab.4. human. [Q96IZ2-1]

Organism-specific databases

CTDi84830.
DisGeNETi84830.
GeneCardsiADTRP.
HGNCiHGNC:21214. ADTRP.
HPAiHPA048113.
MIMi614348. gene.
neXtProtiNX_Q96IZ2.
OpenTargetsiENSG00000111863.
PharmGKBiPA134981312.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000012526.
HOGENOMiHOG000006895.
HOVERGENiHBG050468.
InParanoidiQ96IZ2.
OMAiHNYPSKK.
OrthoDBiEOG091G0LUO.
PhylomeDBiQ96IZ2.
TreeFamiTF318170.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000111863-MONOMER.

Miscellaneous databases

GenomeRNAii84830.
PROiQ96IZ2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000111863.
CleanExiHS_C6orf105.
ExpressionAtlasiQ96IZ2. baseline and differential.
GenevisibleiQ96IZ2. HS.

Family and domain databases

InterProiIPR006838. Far-17a_AIG1.
[Graphical view]
PfamiPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiADTRP_HUMAN
AccessioniPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.