Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Androgen-dependent TFPI-regulating protein

Gene

ADTRP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).1 Publication

Caution

GO - Molecular functioni

  • hydrolase activity Source: UniProtKB

GO - Biological processi

  • cellular response to steroid hormone stimulus Source: UniProtKB
  • long-chain fatty acid catabolic process Source: UniProtKB
  • negative regulation of blood coagulation Source: UniProtKB
  • positive regulation of gene expression Source: UniProtKB

Chemistry databases

SwissLipidsiSLP:000001683

Names & Taxonomyi

Protein namesi
Recommended name:
Androgen-dependent TFPI-regulating protein
Gene namesi
Name:ADTRP
Synonyms:C6orf105
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000111863.12
HGNCiHGNC:21214 ADTRP
MIMi614348 gene
neXtProtiNX_Q96IZ2

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Transmembranei47 – 67HelicalSequence analysisAdd BLAST21
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Transmembranei120 – 140HelicalSequence analysisAdd BLAST21
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Transmembranei190 – 210HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi84830
OpenTargetsiENSG00000111863
PharmGKBiPA134981312

Polymorphism and mutation databases

BioMutaiADTRP
DMDMi83286865

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001901001 – 230Androgen-dependent TFPI-regulating proteinAdd BLAST230

Proteomic databases

PeptideAtlasiQ96IZ2
PRIDEiQ96IZ2

PTM databases

iPTMnetiQ96IZ2
PhosphoSitePlusiQ96IZ2

Expressioni

Tissue specificityi

Expressed in cultured endothelial cells and in placenta.1 Publication

Inductioni

By androgens.1 Publication

Gene expression databases

BgeeiENSG00000111863
CleanExiHS_C6orf105
ExpressionAtlasiQ96IZ2 baseline and differential
GenevisibleiQ96IZ2 HS

Organism-specific databases

HPAiHPA048113

Interactioni

Protein-protein interaction databases

BioGridi1242853 interactors.
IntActiQ96IZ2 3 interactors.
MINTiQ96IZ2

Chemistry databases

BindingDBiQ96IZ2

Structurei

3D structure databases

ProteinModelPortaliQ96IZ2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AIG1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00390000012526
HOGENOMiHOG000006895
HOVERGENiHBG050468
InParanoidiQ96IZ2
OMAiCIYHFLV
OrthoDBiEOG091G0LUO
PhylomeDBiQ96IZ2
TreeFamiTF318170

Family and domain databases

InterProiView protein in InterPro
IPR006838 Far-17a_AIG1
PANTHERiPTHR10989 PTHR10989, 1 hit
PfamiView protein in Pfam
PF04750 Far-17a_AIG1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN
60 70 80 90 100
LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL
110 120 130 140 150
AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP
160 170 180 190 200
SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS
210 220 230
YVFIASIYLL GEKLNHWKWG DMRQPRKKRK
Length:230
Mass (Da):26,842
Last modified:December 1, 2001 - v1
Checksum:i49B964B41C381360
GO
Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL

Show »
Length:248
Mass (Da):28,922
Checksum:i88183242A57FD4AF
GO
Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

Note: No experimental confirmation available.
Show »
Length:255
Mass (Da):29,789
Checksum:i934C3EDDD32B17FF
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024365202V → I. Corresponds to variant dbSNP:rs2076185Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04196552L → LKNRTAGFDIYQPGSFRQL in isoform 2. 1 Publication1
Alternative sequenceiVSP_042868220 – 230GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. CuratedAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA Translation: BAG35936.1
AK300919 mRNA Translation: BAG62551.1
AL022724 Genomic DNA No translation available.
CH471087 Genomic DNA Translation: EAW55304.1
CH471087 Genomic DNA Translation: EAW55306.1
BC007011 mRNA Translation: AAH07011.1
CCDSiCCDS4521.1 [Q96IZ2-1]
CCDS47374.1 [Q96IZ2-2]
RefSeqiNP_001137420.1, NM_001143948.1 [Q96IZ2-2]
NP_116133.1, NM_032744.3 [Q96IZ2-1]
XP_005249511.1, XM_005249454.3 [Q96IZ2-1]
XP_011513258.1, XM_011514956.1 [Q96IZ2-3]
UniGeneiHs.126409

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863 [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863 [Q96IZ2-1]
GeneIDi84830
KEGGihsa:84830
UCSCiuc003nab.4 human [Q96IZ2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiADTRP_HUMAN
AccessioniPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: February 28, 2018
This is version 110 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome