Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96IZ2

- ADTRP_HUMAN

UniProt

Q96IZ2 - ADTRP_HUMAN

Protein

Androgen-dependent TFPI-regulating protein

Gene

ADTRP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 87 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).1 Publication

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Androgen-dependent TFPI-regulating protein
    Gene namesi
    Name:ADTRP
    Synonyms:C6orf105
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21214. ADTRP.

    Subcellular locationi

    Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Colocalized with TFPI and CAV1 in lipid rafts.

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134981312.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 230230Androgen-dependent TFPI-regulating proteinPRO_0000190100Add
    BLAST

    Proteomic databases

    PRIDEiQ96IZ2.

    PTM databases

    PhosphoSiteiQ96IZ2.

    Expressioni

    Tissue specificityi

    Expressed in cultured endothelial cells and in placenta.1 Publication

    Inductioni

    By androgens.1 Publication

    Gene expression databases

    ArrayExpressiQ96IZ2.
    BgeeiQ96IZ2.
    CleanExiHS_C6orf105.
    GenevestigatoriQ96IZ2.

    Organism-specific databases

    HPAiHPA048113.

    Interactioni

    Protein-protein interaction databases

    BioGridi124285. 1 interaction.
    IntActiQ96IZ2. 3 interactions.
    STRINGi9606.ENSP00000404416.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96IZ2.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei4 – 2421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei47 – 6721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei86 – 10621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei120 – 14021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei155 – 17521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei190 – 21021HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the AIG1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG267917.
    HOGENOMiHOG000006895.
    HOVERGENiHBG050468.
    OMAiNHAMHTS.
    PhylomeDBiQ96IZ2.
    TreeFamiTF318170.

    Family and domain databases

    InterProiIPR006838. Far-17a_AIG1.
    [Graphical view]
    PfamiPF04750. Far-17a_AIG1. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN    50
    LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL 100
    AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP 150
    SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS 200
    YVFIASIYLL GEKLNHWKWG DMRQPRKKRK 230
    Length:230
    Mass (Da):26,842
    Last modified:December 1, 2001 - v1
    Checksum:i49B964B41C381360
    GO
    Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         52-52: L → LKNRTAGFDIYQPGSFRQL

    Show »
    Length:248
    Mass (Da):28,922
    Checksum:i88183242A57FD4AF
    GO
    Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

    Note: No experimental confirmation available.

    Show »
    Length:255
    Mass (Da):29,789
    Checksum:i934C3EDDD32B17FF
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti202 – 2021V → I.
    Corresponds to variant rs2076185 [ dbSNP | Ensembl ].
    VAR_024365

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei52 – 521L → LKNRTAGFDIYQPGSFRQL in isoform 2. 1 PublicationVSP_041965
    Alternative sequencei220 – 23011GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. CuratedVSP_042868Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK313114 mRNA. Translation: BAG35936.1.
    AK300919 mRNA. Translation: BAG62551.1.
    AL022724 Genomic DNA. Translation: CAB38130.1.
    AL022724 Genomic DNA. Translation: CAI20503.1.
    CH471087 Genomic DNA. Translation: EAW55304.1.
    CH471087 Genomic DNA. Translation: EAW55306.1.
    BC007011 mRNA. Translation: AAH07011.1.
    CCDSiCCDS4521.1. [Q96IZ2-1]
    CCDS47374.1. [Q96IZ2-2]
    RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
    NP_116133.1. NM_032744.3. [Q96IZ2-1]
    XP_005249511.1. XM_005249454.1. [Q96IZ2-1]
    UniGeneiHs.126409.

    Genome annotation databases

    EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
    ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
    GeneIDi84830.
    KEGGihsa:84830.
    UCSCiuc003nab.3. human. [Q96IZ2-1]
    uc011dip.2. human. [Q96IZ2-2]

    Polymorphism databases

    DMDMi83286865.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK313114 mRNA. Translation: BAG35936.1 .
    AK300919 mRNA. Translation: BAG62551.1 .
    AL022724 Genomic DNA. Translation: CAB38130.1 .
    AL022724 Genomic DNA. Translation: CAI20503.1 .
    CH471087 Genomic DNA. Translation: EAW55304.1 .
    CH471087 Genomic DNA. Translation: EAW55306.1 .
    BC007011 mRNA. Translation: AAH07011.1 .
    CCDSi CCDS4521.1. [Q96IZ2-1 ]
    CCDS47374.1. [Q96IZ2-2 ]
    RefSeqi NP_001137420.1. NM_001143948.1. [Q96IZ2-2 ]
    NP_116133.1. NM_032744.3. [Q96IZ2-1 ]
    XP_005249511.1. XM_005249454.1. [Q96IZ2-1 ]
    UniGenei Hs.126409.

    3D structure databases

    ProteinModelPortali Q96IZ2.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124285. 1 interaction.
    IntActi Q96IZ2. 3 interactions.
    STRINGi 9606.ENSP00000404416.

    PTM databases

    PhosphoSitei Q96IZ2.

    Polymorphism databases

    DMDMi 83286865.

    Proteomic databases

    PRIDEi Q96IZ2.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000229583 ; ENSP00000229583 ; ENSG00000111863 . [Q96IZ2-2 ]
    ENST00000414691 ; ENSP00000404416 ; ENSG00000111863 . [Q96IZ2-1 ]
    GeneIDi 84830.
    KEGGi hsa:84830.
    UCSCi uc003nab.3. human. [Q96IZ2-1 ]
    uc011dip.2. human. [Q96IZ2-2 ]

    Organism-specific databases

    CTDi 84830.
    GeneCardsi GC06M011712.
    HGNCi HGNC:21214. ADTRP.
    HPAi HPA048113.
    MIMi 614348. gene.
    neXtProti NX_Q96IZ2.
    PharmGKBi PA134981312.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG267917.
    HOGENOMi HOG000006895.
    HOVERGENi HBG050468.
    OMAi NHAMHTS.
    PhylomeDBi Q96IZ2.
    TreeFami TF318170.

    Miscellaneous databases

    GenomeRNAii 84830.
    NextBioi 75041.
    PROi Q96IZ2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96IZ2.
    Bgeei Q96IZ2.
    CleanExi HS_C6orf105.
    Genevestigatori Q96IZ2.

    Family and domain databases

    InterProi IPR006838. Far-17a_AIG1.
    [Graphical view ]
    Pfami PF04750. Far-17a_AIG1. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Colon and Small intestine.
    2. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Bone marrow.
    5. "Novel protein ADTRP regulates TFPI expression and function in human endothelial cells in normal conditions and in response to androgen."
      Lupu C., Zhu H., Popescu N.I., Wren J.D., Lupu F.
      Blood 118:4463-4471(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.

    Entry informationi

    Entry nameiADTRP_HUMAN
    AccessioniPrimary (citable) accession number: Q96IZ2
    Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 10, 2005
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 87 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3