SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96IZ2

- ADTRP_HUMAN

UniProt

Q96IZ2 - ADTRP_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Androgen-dependent TFPI-regulating protein

Gene
ADTRP, C6orf105
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Androgen-dependent TFPI-regulating protein
Gene namesi
Name:ADTRP
Synonyms:C6orf105
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 6

Organism-specific databases

HGNCiHGNC:21214. ADTRP.

Subcellular locationi

Cell membrane; Multi-pass membrane protein
Note: Colocalized with TFPI and CAV1 in lipid rafts.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei4 – 2421Helical; Reviewed predictionAdd
BLAST
Transmembranei47 – 6721Helical; Reviewed predictionAdd
BLAST
Transmembranei86 – 10621Helical; Reviewed predictionAdd
BLAST
Transmembranei120 – 14021Helical; Reviewed predictionAdd
BLAST
Transmembranei155 – 17521Helical; Reviewed predictionAdd
BLAST
Transmembranei190 – 21021Helical; Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134981312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 230230Androgen-dependent TFPI-regulating proteinPRO_0000190100Add
BLAST

Proteomic databases

PRIDEiQ96IZ2.

PTM databases

PhosphoSiteiQ96IZ2.

Expressioni

Tissue specificityi

Expressed in cultured endothelial cells and in placenta.1 Publication

Inductioni

By androgens.1 Publication

Gene expression databases

ArrayExpressiQ96IZ2.
BgeeiQ96IZ2.
CleanExiHS_C6orf105.
GenevestigatoriQ96IZ2.

Organism-specific databases

HPAiHPA048113.

Interactioni

Protein-protein interaction databases

BioGridi124285. 1 interaction.
IntActiQ96IZ2. 3 interactions.
STRINGi9606.ENSP00000404416.

Structurei

3D structure databases

ProteinModelPortaliQ96IZ2.

Family & Domainsi

Sequence similaritiesi

Belongs to the AIG1 family.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG267917.
HOGENOMiHOG000006895.
HOVERGENiHBG050468.
OMAiNHAMHTS.
PhylomeDBiQ96IZ2.
TreeFamiTF318170.

Family and domain databases

InterProiIPR006838. Far-17a_AIG1.
[Graphical view]
PfamiPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN    50
LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL 100
AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP 150
SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS 200
YVFIASIYLL GEKLNHWKWG DMRQPRKKRK 230
Length:230
Mass (Da):26,842
Last modified:December 1, 2001 - v1
Checksum:i49B964B41C381360
GO
Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL

Show »
Length:248
Mass (Da):28,922
Checksum:i88183242A57FD4AF
GO
Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):29,789
Checksum:i934C3EDDD32B17FF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti202 – 2021V → I.
Corresponds to variant rs2076185 [ dbSNP | Ensembl ].
VAR_024365

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei52 – 521L → LKNRTAGFDIYQPGSFRQL in isoform 2. VSP_041965
Alternative sequencei220 – 23011GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. VSP_042868Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSiCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.1. [Q96IZ2-1]
UniGeneiHs.126409.

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000379413; ENSP00000368723; ENSG00000111863. [Q96IZ2-3]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneIDi84830.
KEGGihsa:84830.
UCSCiuc003nab.3. human. [Q96IZ2-1]
uc011dip.2. human. [Q96IZ2-2]

Polymorphism databases

DMDMi83286865.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK313114 mRNA. Translation: BAG35936.1 .
AK300919 mRNA. Translation: BAG62551.1 .
AL022724 Genomic DNA. Translation: CAB38130.1 .
AL022724 Genomic DNA. Translation: CAI20503.1 .
CH471087 Genomic DNA. Translation: EAW55304.1 .
CH471087 Genomic DNA. Translation: EAW55306.1 .
BC007011 mRNA. Translation: AAH07011.1 .
CCDSi CCDS4521.1. [Q96IZ2-1 ]
CCDS47374.1. [Q96IZ2-2 ]
RefSeqi NP_001137420.1. NM_001143948.1. [Q96IZ2-2 ]
NP_116133.1. NM_032744.3. [Q96IZ2-1 ]
XP_005249511.1. XM_005249454.1. [Q96IZ2-1 ]
UniGenei Hs.126409.

3D structure databases

ProteinModelPortali Q96IZ2.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124285. 1 interaction.
IntActi Q96IZ2. 3 interactions.
STRINGi 9606.ENSP00000404416.

PTM databases

PhosphoSitei Q96IZ2.

Polymorphism databases

DMDMi 83286865.

Proteomic databases

PRIDEi Q96IZ2.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000229583 ; ENSP00000229583 ; ENSG00000111863 . [Q96IZ2-2 ]
ENST00000379413 ; ENSP00000368723 ; ENSG00000111863 . [Q96IZ2-3 ]
ENST00000414691 ; ENSP00000404416 ; ENSG00000111863 . [Q96IZ2-1 ]
GeneIDi 84830.
KEGGi hsa:84830.
UCSCi uc003nab.3. human. [Q96IZ2-1 ]
uc011dip.2. human. [Q96IZ2-2 ]

Organism-specific databases

CTDi 84830.
GeneCardsi GC06M011712.
HGNCi HGNC:21214. ADTRP.
HPAi HPA048113.
MIMi 614348. gene.
neXtProti NX_Q96IZ2.
PharmGKBi PA134981312.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG267917.
HOGENOMi HOG000006895.
HOVERGENi HBG050468.
OMAi NHAMHTS.
PhylomeDBi Q96IZ2.
TreeFami TF318170.

Miscellaneous databases

GenomeRNAii 84830.
NextBioi 75041.
PROi Q96IZ2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96IZ2.
Bgeei Q96IZ2.
CleanExi HS_C6orf105.
Genevestigatori Q96IZ2.

Family and domain databases

InterProi IPR006838. Far-17a_AIG1.
[Graphical view ]
Pfami PF04750. Far-17a_AIG1. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Colon and Small intestine.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  5. "Novel protein ADTRP regulates TFPI expression and function in human endothelial cells in normal conditions and in response to androgen."
    Lupu C., Zhu H., Popescu N.I., Wren J.D., Lupu F.
    Blood 118:4463-4471(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.

Entry informationi

Entry nameiADTRP_HUMAN
AccessioniPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi