Q96IZ2 (ADTRP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 75.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Androgen-dependent TFPI-regulating protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 230 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro). Ref.5 |
| Subcellular location | Cell membrane; Multi-pass membrane protein. Note: Colocalized with TFPI and CAV1 in lipid rafts. Ref.5 |
| Tissue specificity | Expressed in cultured endothelial cells and in placenta. Ref.5 |
| Induction | By androgens. Ref.5 |
| Sequence similarities | Belongs to the AIG1 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IZ2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IZ2-2) The sequence of this isoform differs from the canonical sequence as follows: 52-52: L → LKNRTAGFDIYQPGSFRQL | ||||||
| Isoform 3 (identifier: Q96IZ2-3) The sequence of this isoform differs from the canonical sequence as follows: 220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 230 | 230 | Androgen-dependent TFPI-regulating protein | PRO_0000190100 | |||||
Regions | |||||||||
| Transmembrane | 4 – 24 | 21 | Helical; Potential | ||||||
| Transmembrane | 47 – 67 | 21 | Helical; Potential | ||||||
| Transmembrane | 86 – 106 | 21 | Helical; Potential | ||||||
| Transmembrane | 120 – 140 | 21 | Helical; Potential | ||||||
| Transmembrane | 155 – 175 | 21 | Helical; Potential | ||||||
| Transmembrane | 190 – 210 | 21 | Helical; Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 52 | 1 | L → LKNRTAGFDIYQPGSFRQL in isoform 2. | VSP_041965 | |||||
| Alternative sequence | 220 – 230 | 11 | GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. | VSP_042868 | |||||
| Natural variant | 202 | 1 | V → I. Corresponds to variant rs2076185 [ dbSNP | Ensembl ]. | VAR_024365 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK313114 mRNA. Translation: BAG35936.1. AK300919 mRNA. Translation: BAG62551.1. AL022724 Genomic DNA. Translation: CAB38130.1. AL022724 Genomic DNA. Translation: CAI20503.1. CH471087 Genomic DNA. Translation: EAW55304.1. CH471087 Genomic DNA. Translation: EAW55306.1. BC007011 mRNA. Translation: AAH07011.1. |
| IPI | IPI00067155. IPI00965560. |
| RefSeq | NP_001137420.1. NM_001143948.1. NP_116133.1. NM_032744.3. |
| UniGene | Hs.126409. |
3D structure databases | |
| ProteinModelPortal | Q96IZ2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96IZ2. 1 interaction. |
| STRING | 9606.ENSP00000404416. |
PTM databases | |
| PhosphoSite | Q96IZ2. |
Polymorphism databases | |
| DMDM | 83286865. |
Proteomic databases | |
| PRIDE | Q96IZ2. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000229583; ENSP00000229583; ENSG00000111863. ENST00000379413; ENSP00000368723; ENSG00000111863. ENST00000414691; ENSP00000404416; ENSG00000111863. |
| GeneID | 84830. |
| KEGG | hsa:84830. |
| UCSC | uc003nab.3. human. |
Organism-specific databases | |
| CTD | 84830. |
| GeneCards | GC06M011712. |
| HGNC | HGNC:21214. ADTRP. |
| HPA | HPA048113. |
| MIM | 614348. gene. |
| neXtProt | NX_Q96IZ2. |
| PharmGKB | PA134981312. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG267917. |
| HOGENOM | HOG000006895. |
| HOVERGEN | HBG050468. |
| OMA | GQWKYLT. |
| PhylomeDB | Q96IZ2. |
Gene expression databases | |
| ArrayExpress | Q96IZ2. |
| Bgee | Q96IZ2. |
| CleanEx | HS_C6orf105. |
| Genevestigator | Q96IZ2. |
| GermOnline | ENSG00000111863. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR006838. Far-17a_AIG1. [Graphical view] |
| Pfam | PF04750. Far-17a_AIG1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84830. |
| NextBio | 75041. |
| SOURCE | Search... |
Entry information
| Entry name | ADTRP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IZ2 Secondary accession number(s): B2R7T9, B4DV39, Q5THW1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
