Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Androgen-dependent TFPI-regulating protein

Gene

ADTRP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Regulates the expression and the cell-associated anticoagulant activity of the inhibitor TFPI in endothelial cells (in vitro).1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
Androgen-dependent TFPI-regulating protein
Gene namesi
Name:ADTRP
Synonyms:C6orf105
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21214. ADTRP.

Subcellular locationi

Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Colocalized with TFPI and CAV1 in lipid rafts.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei4 – 2421HelicalSequence AnalysisAdd
BLAST
Transmembranei47 – 6721HelicalSequence AnalysisAdd
BLAST
Transmembranei86 – 10621HelicalSequence AnalysisAdd
BLAST
Transmembranei120 – 14021HelicalSequence AnalysisAdd
BLAST
Transmembranei155 – 17521HelicalSequence AnalysisAdd
BLAST
Transmembranei190 – 21021HelicalSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134981312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 230230Androgen-dependent TFPI-regulating proteinPRO_0000190100Add
BLAST

Proteomic databases

PRIDEiQ96IZ2.

PTM databases

PhosphoSiteiQ96IZ2.

Expressioni

Tissue specificityi

Expressed in cultured endothelial cells and in placenta.1 Publication

Inductioni

By androgens.1 Publication

Gene expression databases

BgeeiQ96IZ2.
CleanExiHS_C6orf105.
ExpressionAtlasiQ96IZ2. baseline and differential.
GenevestigatoriQ96IZ2.

Organism-specific databases

HPAiHPA048113.

Interactioni

Protein-protein interaction databases

BioGridi124285. 1 interaction.
IntActiQ96IZ2. 3 interactions.
STRINGi9606.ENSP00000404416.

Structurei

3D structure databases

ProteinModelPortaliQ96IZ2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AIG1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG267917.
GeneTreeiENSGT00390000012526.
HOGENOMiHOG000006895.
HOVERGENiHBG050468.
InParanoidiQ96IZ2.
OMAiQAIFFGV.
PhylomeDBiQ96IZ2.
TreeFamiTF318170.

Family and domain databases

InterProiIPR006838. Far-17a_AIG1.
[Graphical view]
PfamiPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKTSTCIYH FLVLSWYTFL NYYISQEGKD EVKPKILANG ARWKYMTLLN
60 70 80 90 100
LLLQTIFYGV TCLDDVLKRT KGGKDIKFLT AFRDLLFTTL AFPVSTFVFL
110 120 130 140 150
AFWILFLYNR DLIYPKVLDT VIPVWLNHAM HTFIFPITLA EVVLRPHSYP
160 170 180 190 200
SKKTGLTLLA AASIAYISRI LWLYFETGTW VYPVFAKLSL LGLAAFFSLS
210 220 230
YVFIASIYLL GEKLNHWKWG DMRQPRKKRK
Length:230
Mass (Da):26,842
Last modified:November 30, 2001 - v1
Checksum:i49B964B41C381360
GO
Isoform 2 (identifier: Q96IZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     52-52: L → LKNRTAGFDIYQPGSFRQL

Show »
Length:248
Mass (Da):28,922
Checksum:i88183242A57FD4AF
GO
Isoform 3 (identifier: Q96IZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     220-230: GDMRQPRKKRK → VSVQILQRWRLESVGICFQWPDWKSPAKHQLVKNIR

Note: No experimental confirmation available.

Show »
Length:255
Mass (Da):29,789
Checksum:i934C3EDDD32B17FF
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti202 – 2021V → I.
Corresponds to variant rs2076185 [ dbSNP | Ensembl ].
VAR_024365

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei52 – 521L → LKNRTAGFDIYQPGSFRQL in isoform 2. 1 PublicationVSP_041965
Alternative sequencei220 – 23011GDMRQPRKKRK → VSVQILQRWRLESVGICFQW PDWKSPAKHQLVKNIR in isoform 3. CuratedVSP_042868Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSiCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.1. [Q96IZ2-1]
UniGeneiHs.126409.

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneIDi84830.
KEGGihsa:84830.
UCSCiuc003nab.3. human. [Q96IZ2-1]
uc011dip.2. human. [Q96IZ2-2]

Polymorphism databases

DMDMi83286865.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK313114 mRNA. Translation: BAG35936.1.
AK300919 mRNA. Translation: BAG62551.1.
AL022724 Genomic DNA. Translation: CAB38130.1.
AL022724 Genomic DNA. Translation: CAI20503.1.
CH471087 Genomic DNA. Translation: EAW55304.1.
CH471087 Genomic DNA. Translation: EAW55306.1.
BC007011 mRNA. Translation: AAH07011.1.
CCDSiCCDS4521.1. [Q96IZ2-1]
CCDS47374.1. [Q96IZ2-2]
RefSeqiNP_001137420.1. NM_001143948.1. [Q96IZ2-2]
NP_116133.1. NM_032744.3. [Q96IZ2-1]
XP_005249511.1. XM_005249454.1. [Q96IZ2-1]
UniGeneiHs.126409.

3D structure databases

ProteinModelPortaliQ96IZ2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124285. 1 interaction.
IntActiQ96IZ2. 3 interactions.
STRINGi9606.ENSP00000404416.

PTM databases

PhosphoSiteiQ96IZ2.

Polymorphism databases

DMDMi83286865.

Proteomic databases

PRIDEiQ96IZ2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000229583; ENSP00000229583; ENSG00000111863. [Q96IZ2-2]
ENST00000414691; ENSP00000404416; ENSG00000111863. [Q96IZ2-1]
GeneIDi84830.
KEGGihsa:84830.
UCSCiuc003nab.3. human. [Q96IZ2-1]
uc011dip.2. human. [Q96IZ2-2]

Organism-specific databases

CTDi84830.
GeneCardsiGC06M011712.
HGNCiHGNC:21214. ADTRP.
HPAiHPA048113.
MIMi614348. gene.
neXtProtiNX_Q96IZ2.
PharmGKBiPA134981312.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG267917.
GeneTreeiENSGT00390000012526.
HOGENOMiHOG000006895.
HOVERGENiHBG050468.
InParanoidiQ96IZ2.
OMAiQAIFFGV.
PhylomeDBiQ96IZ2.
TreeFamiTF318170.

Miscellaneous databases

GenomeRNAii84830.
NextBioi75041.
PROiQ96IZ2.
SOURCEiSearch...

Gene expression databases

BgeeiQ96IZ2.
CleanExiHS_C6orf105.
ExpressionAtlasiQ96IZ2. baseline and differential.
GenevestigatoriQ96IZ2.

Family and domain databases

InterProiIPR006838. Far-17a_AIG1.
[Graphical view]
PfamiPF04750. Far-17a_AIG1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Colon and Small intestine.
  2. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Bone marrow.
  5. "Novel protein ADTRP regulates TFPI expression and function in human endothelial cells in normal conditions and in response to androgen."
    Lupu C., Zhu H., Popescu N.I., Wren J.D., Lupu F.
    Blood 118:4463-4471(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, INDUCTION.

Entry informationi

Entry nameiADTRP_HUMAN
AccessioniPrimary (citable) accession number: Q96IZ2
Secondary accession number(s): B2R7T9, B4DV39, Q5THW1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 9, 2005
Last sequence update: November 30, 2001
Last modified: January 6, 2015
This is version 89 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.