Reviewed,
UniProtKB/Swiss-Prot Q96IY4 (CBPB2_HUMAN)
Last modified
February 9, 2010.
Version 75.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Carboxypeptidase B2 EC=3.4.17.20 Alternative name(s): Carboxypeptidase U Short name=CPU Thrombin-activable fibrinolysis inhibitor Short name=TAFI Plasma carboxypeptidase B Short name=pCPB | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. |
| Catalytic activity | Release of C-terminal Arg and Lys from a polypeptide. |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Subcellular location | |
| Tissue specificity | Plasma; synthesized in the liver. |
| Sequence similarities | Belongs to the peptidase M14 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal |
| Ligand | Metal-binding Zinc |
| Molecular function | Carboxypeptidase Hydrolase Metalloprotease Protease |
| PTM | Disulfide bond Glycoprotein Zymogen |
| Technical term | 3D-structure Complete proteome Direct protein sequencing |
| Gene Ontology (GO) | |
| Biological process | proteolysis Ref.1 Traceable author statement. Source: ProtInc |
| Cellular component | extracellular space Ref.1 Traceable author statement. Source: ProtInc |
| Molecular function | metallocarboxypeptidase activity Ref.1 Traceable author statement. Source: ProtInc zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IY4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IY4-2) The sequence of this isoform differs from the canonical sequence as follows: 198-234: Missing. 384-423: IELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIRNV → SNPPVEKLLPLSLK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 23 – 114 | 92 | Activation peptide | PRO_0000004377 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 115 – 423 | 309 | Carboxypeptidase B2 | PRO_0000004378 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 385 | 1 | Nucleophile By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 181 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 184 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 310 | 1 | Zinc By similarity | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 44 | 1 | N-linked (GlcNAc...) Ref.8 Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 73 | 1 | N-linked (GlcNAc...) Ref.8 Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 85 | 1 | N-linked (GlcNAc...) Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 108 | 1 | N-linked (GlcNAc...) Ref.8 Ref.9 Ref.10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 241 | 1 | N-linked (GlcNAc...); partial Ref.9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 178 ↔ 191 | Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 250 ↔ 274 | Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 265 ↔ 279 | Ref.9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 234 | 37 | Missing in isoform 2. | VSP_013446 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 384 – 423 | 40 | IELRD…VIRNV → SNPPVEKLLPLSLK in isoform 2. | VSP_013447 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 169 | 1 | A → T: dbSNP rs3742264. Ref.1 Ref.4 | VAR_032565 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | T → I: dbSNP rs1926447. Ref.2 Ref.5 Ref.6 | VAR_022258 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 25 | 1 | S → T in BAA90475. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 28 – 31 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 48 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 58 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 61 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 68 – 72 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 86 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 96 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 107 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 108 – 110 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 121 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 139 | 14 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 141 – 143 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 148 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 159 – 163 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 173 – 177 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 186 – 194 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 198 – 201 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 208 – 214 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 216 – 221 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 229 – 233 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 255 – 257 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 262 – 265 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 272 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 299 | 13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 300 – 302 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 303 – 310 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 315 – 317 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 347 | 18 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 371 – 375 | 5 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 385 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 398 – 400 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 401 – 422 | 22 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma." Eaton D.L., Malloy B.E., Tsai S.P., Henzel W., Drayna D. J. Biol. Chem. 266:21833-21838(1991) [PubMed: 1939207] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, INTERACTION WITH PLASMINOGEN, VARIANT THR-169. Tissue: Liver. |
| [2] | "Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma." Matsumoto A. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), VARIANT ILE-347. |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-169. Tissue: Liver. |
| [5] | SeattleSNPs variation discovery resource Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT ILE-347. |
| [6] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed: 15057823] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ILE-347. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Skeletal muscle. |
| [8] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed: 16335952] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-44; ASN-73 AND ASN-108, MASS SPECTROMETRY. Tissue: Plasma. |
| [9] | "Post-translational modifications of human thrombin-activatable fibrinolysis inhibitor (TAFI): evidence for a large shift in the isoelectric point and reduced solubility upon activation." Valnickova Z., Christensen T., Skottrup P., Thogersen I.B., Hojrup P., Enghild J.J. Biochemistry 45:1525-1535(2006) [PubMed: 16445295] [Abstract] Cited for: GLYCOSYLATION AT ASN-44; ASN-73; ASN-85; ASN-108 AND ASN-241, DISULFIDE BONDS. |
| [10] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed: 19159218] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-108, MASS SPECTROMETRY. Tissue: Liver. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M75106 mRNA. Translation: AAA60042.1. AB011969 mRNA. Translation: BAA90475.1. BT006936 mRNA. Translation: AAP35582.1. AK290829 mRNA. Translation: BAF83518.1. AY714780 Genomic DNA. Translation: AAT97987.1. AL157758, AL137141 Genomic DNA. Translation: CAI10904.1. AL157758, AL137141 Genomic DNA. Translation: CAI10905.1. AL137141, AL157758 Genomic DNA. Translation: CAI12170.1. AL137141, AL157758 Genomic DNA. Translation: CAI12171.1. BC007057 mRNA. Translation: AAH07057.1. | ||||||||||||||||||||||||
| IPI | IPI00293057. IPI00329775. | ||||||||||||||||||||||||
| PIR | A41204. | ||||||||||||||||||||||||
| RefSeq | NP_001863.2. NP_057497.3. | ||||||||||||||||||||||||
| UniGene | Hs.512937 | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| STRING | Q96IY4. | ||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||
| MEROPS | M14.009. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q96IY4. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PRIDE | Q96IY4. | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000181383; ENSP00000181383; ENSG00000080618; Homo sapiens. [Genome view] | ||||||||||||||||||||||||
| GeneID | 1361. | ||||||||||||||||||||||||
| KEGG | hsa:1361. | ||||||||||||||||||||||||
| UCSC | uc001vaw.1. human. uc001vax.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 1361. | ||||||||||||||||||||||||
| GeneCards | GC13M045525. | ||||||||||||||||||||||||
| HGNC | HGNC:2300. CPB2. | ||||||||||||||||||||||||
| HPA | HPA004146. | ||||||||||||||||||||||||
| MIM | 603101. gene. | ||||||||||||||||||||||||
| PharmGKB | PA26822. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | prNOG09285. | ||||||||||||||||||||||||
| HOGENOM | HBG445627. | ||||||||||||||||||||||||
| HOVERGEN | Q96IY4. | ||||||||||||||||||||||||
| InParanoid | Q96IY4. | ||||||||||||||||||||||||
| PhylomeDB | Q96IY4. | ||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||
| BRENDA | 3.4.17.20. 247. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q96IY4. | ||||||||||||||||||||||||
| Bgee | Q96IY4. | ||||||||||||||||||||||||
| CleanEx | HS_CPB2. | ||||||||||||||||||||||||
| Genevestigator | Q96IY4. | ||||||||||||||||||||||||
| GermOnline | ENSG00000080618. Homo sapiens. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| InterPro | IPR000834. Peptidase_M14. IPR009020. Prot_inh_propept. [Graphical view] | ||||||||||||||||||||||||
| Pfam | PF00246. Peptidase_M14. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PRINTS | PR00765. CRBOXYPTASEA. | ||||||||||||||||||||||||
| SMART | SM00631. Zn_pept. 1 hit. [Graphical view] | ||||||||||||||||||||||||
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] | ||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other Resources | |||||||||||||||||||||||||
| NextBio | 5513. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | CBPB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IY4 Secondary accession number(s): A8K464 Q9P2Y6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


