Q96IY4 (CBPB2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Carboxypeptidase B2 EC=3.4.17.20 Alternative name(s): Carboxypeptidase U Short name=CPU Plasma carboxypeptidase B Short name=pCPB Thrombin-activable fibrinolysis inhibitor Short name=TAFI | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 423 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Cleaves C-terminal arginine or lysine residues from biologically active peptides such as kinins or anaphylatoxins in the circulation thereby regulating their activities. Down-regulates fibrinolysis by removing C-terminal lysine residues from fibrin that has already been partially degraded by plasmin. Ref.8 |
| Catalytic activity | Release of C-terminal Arg and Lys from a polypeptide. Ref.8 |
| Cofactor | Binds 1 zinc ion per subunit. |
| Enzyme regulation | TAFI/CPB2 is unique among carboxypeptidases in that it spontaneously inactivates with a short half-life, a property that is crucial for its role in controlling blood clot lysis. The zymogen is stabilized by interactions with the activation peptide. Release of the activation peptide increases a dynamic flap mobility and in time this leads to conformational changes that disrupt the catalytic site and expose a cryptic thrombin-cleavage site present at Arg-324. Ref.13 |
| Subcellular location | |
| Tissue specificity | Plasma; synthesized in the liver. |
| Post-translational modification | N-glycosylated. N-glycan at Asn-108: Hex5HexNAc4. Ref.10 Ref.12 Ref.13 |
| Sequence similarities | Belongs to the peptidase M14 family. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IY4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IY4-2) The sequence of this isoform differs from the canonical sequence as follows: 198-234: Missing. 384-423: IELRDTGTYGFLLPERYIKPTCREAFAAVSKIAWHVIRNV → SNPPVEKLLPLSLK |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 22 | 22 | Potential | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Propeptide | 23 – 114 | 92 | Activation peptide | PRO_0000004377 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 115 – 423 | 309 | Carboxypeptidase B2 | PRO_0000004378 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 385 | 1 | Nucleophile Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 181 | 1 | Zinc; catalytic | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 184 | 1 | Zinc; catalytic | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Metal binding | 310 | 1 | Zinc; catalytic | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 324 – 325 | 2 | Cleavage; by thrombin | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 44 | 1 | N-linked (GlcNAc...) Ref.9 Ref.10 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 73 | 1 | N-linked (GlcNAc...) Ref.9 Ref.10 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 85 | 1 | N-linked (GlcNAc...) Ref.10 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 108 | 1 | N-linked (GlcNAc...) (complex) Ref.9 Ref.10 Ref.11 Ref.12 Ref.13 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Glycosylation | 241 | 1 | N-linked (GlcNAc...); partial Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 178 ↔ 191 | Ref.10 Ref.13 Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 250 ↔ 274 | Ref.10 Ref.13 Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Disulfide bond | 265 ↔ 279 | Ref.10 Ref.13 Ref.14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 198 – 234 | 37 | Missing in isoform 2. | VSP_013446 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 384 – 423 | 40 | IELRD…VIRNV → SNPPVEKLLPLSLK in isoform 2. | VSP_013447 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 169 | 1 | A → T. Ref.1 Ref.4 Corresponds to variant rs3742264 [ dbSNP | Ensembl ]. | VAR_032565 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 347 | 1 | I → T. Ref.1 Ref.3 Ref.4 Ref.5 Ref.7 Corresponds to variant rs1926447 [ dbSNP | Ensembl ]. | VAR_022258 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 25 | 1 | S → T in BAA90475. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 25 – 31 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 36 – 48 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 49 – 58 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 59 – 61 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 68 – 73 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 86 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 91 – 96 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 98 – 107 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 108 – 110 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 118 – 121 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 126 – 139 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 141 – 143 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 144 – 151 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 157 – 163 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 172 – 178 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 186 – 200 | 15 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 201 – 204 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 206 – 214 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 215 – 221 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 225 – 233 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 255 – 257 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 262 – 265 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 271 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 287 – 298 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 299 – 302 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 303 – 310 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 312 – 319 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 321 – 325 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 330 – 347 | 18 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 354 – 357 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 358 – 361 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 369 – 375 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 380 – 385 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 389 – 392 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 393 – 395 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 398 – 400 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 401 – 422 | 22 | |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma." Eaton D.L., Malloy B.E., Tsai S.P., Henzel W., Drayna D. J. Biol. Chem. 266:21833-21838(1991) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), PARTIAL PROTEIN SEQUENCE, INTERACTION WITH PLASMINOGEN, VARIANTS THR-169 AND THR-347. Tissue: Liver. |
| [2] | "Isolation, molecular cloning, and partial characterization of a novel carboxypeptidase B from human plasma." Matsumoto A. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). |
| [3] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-347. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-169 AND THR-347. Tissue: Liver. |
| [5] | SeattleSNPs variation discovery resource Submitted (AUG-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA], VARIANT THR-347. |
| [6] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-347. Tissue: Skeletal muscle. |
| [8] | "Characterization of plasmin-mediated activation of plasma procarboxypeptidase B. Modulation by glycosaminoglycans." Mao S.S., Cooper C.M., Wood T., Shafer J.A., Gardell S.J. J. Biol. Chem. 274:35046-35052(1999) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY. |
| [9] | "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry." Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E., Moore R.J., Smith R.D. J. Proteome Res. 4:2070-2080(2005) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-44; ASN-73 AND ASN-108, MASS SPECTROMETRY. Tissue: Plasma. |
| [10] | "Post-translational modifications of human thrombin-activatable fibrinolysis inhibitor (TAFI): evidence for a large shift in the isoelectric point and reduced solubility upon activation." Valnickova Z., Christensen T., Skottrup P., Thogersen I.B., Hojrup P., Enghild J.J. Biochemistry 45:1525-1535(2006) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-44; ASN-73; ASN-85; ASN-108 AND ASN-241, DISULFIDE BONDS. |
| [11] | "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry." Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H. J. Proteome Res. 8:651-661(2009) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-108, MASS SPECTROMETRY. Tissue: Liver. |
| [12] | "Human urinary glycoproteomics; attachment site specific analysis of N-and O-linked glycosylations by CID and ECD." Halim A., Nilsson J., Ruetschi U., Hesse C., Larson G. Mol. Cell. Proteomics 0:0-0(2011) [PubMed] [Europe PMC] [Abstract] Cited for: GLYCOSYLATION AT ASN-108, STRUCTURE OF CARBOHYDRATES, MASS SPECTROMETRY. |
| [13] | "Crystal structures of TAFI elucidate the inactivation mechanism of activated TAFI: a novel mechanism for enzyme autoregulation." Marx P.F., Brondijk T.H., Plug T., Romijn R.A., Hemrika W., Meijers J.C., Huizinga E.G. Blood 112:2803-2809(2008) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.8 ANGSTROMS) OF 24-423 ALONE AND IN COMPLEX WITH INHIBITOR, GLYCOSYLATION AT ASN-44; ASN-73; ASN-85 AND ASN-108, ACTIVE SITE, ZINC-BINDING SITES, ENZYME REGULATION, DISULFIDE BONDS. |
| [14] | "Insights into the molecular inactivation mechanism of human activated thrombin-activatable fibrinolysis inhibitor." Sanglas L., Arolas J.L., Valnickova Z., Aviles F.X., Enghild J.J., Gomis-Ruth F.X. J. Thromb. Haemost. 8:1056-1065(2010) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.5 ANGSTROMS) OF 115-423 IN COMPLEX WITH INHIBITOR, DISULFIDE BONDS. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | M75106 mRNA. Translation: AAA60042.1. AB011969 mRNA. Translation: BAA90475.1. BT006936 mRNA. Translation: AAP35582.1. AK290829 mRNA. Translation: BAF83518.1. AY714780 Genomic DNA. Translation: AAT97987.1. AL157758, AL137141 Genomic DNA. Translation: CAI10904.1. AL157758, AL137141 Genomic DNA. Translation: CAI10905.1. AL137141, AL157758 Genomic DNA. Translation: CAI12170.1. AL137141, AL157758 Genomic DNA. Translation: CAI12171.1. BC007057 mRNA. Translation: AAH07057.1. | ||||||||||||||||||||||||||||||
| IPI | IPI00293057. IPI00329775. | ||||||||||||||||||||||||||||||
| PIR | A41204. | ||||||||||||||||||||||||||||||
| RefSeq | NP_001863.2. NM_001872.3. | ||||||||||||||||||||||||||||||
| UniGene | Hs.512937. | ||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||
| ProteinModelPortal | Q96IY4. | ||||||||||||||||||||||||||||||
| SMR | Q96IY4. Positions 24-423. | ||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||
| IntAct | Q96IY4. 1 interaction. | ||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000181383. | ||||||||||||||||||||||||||||||
Protein family/group databases | |||||||||||||||||||||||||||||||
| MEROPS | M14.009. | ||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||
| PhosphoSite | Q96IY4. | ||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||
| DMDM | 62899885. | ||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||
| PaxDb | Q96IY4. | ||||||||||||||||||||||||||||||
| PRIDE | Q96IY4. | ||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||
| DNASU | 1361. | ||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||
| Ensembl | ENST00000181383; ENSP00000181383; ENSG00000080618. ENST00000439329; ENSP00000400714; ENSG00000080618. | ||||||||||||||||||||||||||||||
| GeneID | 1361. | ||||||||||||||||||||||||||||||
| KEGG | hsa:1361. | ||||||||||||||||||||||||||||||
| UCSC | uc001vaw.3. human. uc001vax.3. human. | ||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||
| CTD | 1361. | ||||||||||||||||||||||||||||||
| GeneCards | GC13M046627. | ||||||||||||||||||||||||||||||
| HGNC | HGNC:2300. CPB2. | ||||||||||||||||||||||||||||||
| HPA | HPA004146. | ||||||||||||||||||||||||||||||
| MIM | 603101. gene. | ||||||||||||||||||||||||||||||
| neXtProt | NX_Q96IY4. | ||||||||||||||||||||||||||||||
| PharmGKB | PA26822. | ||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||
| eggNOG | COG2866. | ||||||||||||||||||||||||||||||
| HOGENOM | HOG000252968. | ||||||||||||||||||||||||||||||
| HOVERGEN | HBG050815. | ||||||||||||||||||||||||||||||
| InParanoid | Q96IY4. | ||||||||||||||||||||||||||||||
| KO | K01300. | ||||||||||||||||||||||||||||||
| OMA | LYPESEP. | ||||||||||||||||||||||||||||||
| OrthoDB | EOG4NKBVH. | ||||||||||||||||||||||||||||||
| PhylomeDB | Q96IY4. | ||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||
| Bgee | Q96IY4. | ||||||||||||||||||||||||||||||
| CleanEx | HS_CPB2. | ||||||||||||||||||||||||||||||
| Genevestigator | Q96IY4. | ||||||||||||||||||||||||||||||
| GermOnline | ENSG00000080618. Homo sapiens. | ||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||
| Gene3D | 3.30.70.340. 1 hit. | ||||||||||||||||||||||||||||||
| InterPro | IPR000834. Peptidase_M14. IPR003146. Prot_inh_M14A. IPR009020. Prot_inh_propept. [Graphical view] | ||||||||||||||||||||||||||||||
| Pfam | PF00246. Peptidase_M14. 1 hit. PF02244. Propep_M14. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| PRINTS | PR00765. CRBOXYPTASEA. | ||||||||||||||||||||||||||||||
| SMART | SM00631. Zn_pept. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||
| SUPFAM | SSF54897. Prot_inh_propept. 1 hit. | ||||||||||||||||||||||||||||||
| PROSITE | PS00132. CARBOXYPEPT_ZN_1. False negative. PS00133. CARBOXYPEPT_ZN_2. False negative. [Graphical view] | ||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||
| BindingDB | Q96IY4. | ||||||||||||||||||||||||||||||
| ChEMBL | CHEMBL3419. | ||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q96IY4. | ||||||||||||||||||||||||||||||
| GenomeRNAi | 1361. | ||||||||||||||||||||||||||||||
| NextBio | 5513. | ||||||||||||||||||||||||||||||
| PMAP-CutDB | A8K464. | ||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||
Entry information
| Entry name | CBPB2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IY4 Secondary accession number(s): A8K464 Q9P2Y6 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
