SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96IU4

- ABHEB_HUMAN

UniProt

Q96IU4 - ABHEB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Alpha/beta hydrolase domain-containing protein 14B
Gene
ABHD14B, CIB
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei111 – 1111Charge relay system By similarity
Active sitei162 – 1621Charge relay system By similarity
Active sitei188 – 1881Charge relay system By similarity

GO - Molecular functioni

  1. hydrolase activity Source: UniProt
  2. protein binding Source: UniProt

GO - Biological processi

  1. metabolic process Source: GOC
  2. positive regulation of transcription from RNA polymerase II promoter Source: UniProt
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Protein family/group databases

MEROPSiS33.983.

Names & Taxonomyi

Protein namesi
Recommended name:
Alpha/beta hydrolase domain-containing protein 14B (EC:3.-.-.-)
Short name:
Abhydrolase domain-containing protein 14B
Alternative name(s):
CCG1-interacting factor B
Gene namesi
Name:ABHD14B
Synonyms:CIB
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:28235. ABHD14B.

Subcellular locationi

Cytoplasm. Nucleus
Note: Predominantly cytoplasmic.2 Publications

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. cytosol Source: UniProt
  3. extracellular vesicular exosome Source: UniProt
  4. nucleolus Source: HPA
  5. nucleus Source: UniProt
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672660.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methioninei1 – 11Removed1 Publication
Chaini2 – 210209Alpha/beta hydrolase domain-containing protein 14B
PRO_0000065038Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylalanine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ96IU4.
PaxDbiQ96IU4.
PeptideAtlasiQ96IU4.
PRIDEiQ96IU4.

2D gel databases

OGPiQ96IU4.
REPRODUCTION-2DPAGEIPI00063827.
SWISS-2DPAGEQ96IU4.

PTM databases

PhosphoSiteiQ96IU4.

Expressioni

Tissue specificityi

Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.1 Publication

Gene expression databases

ArrayExpressiQ96IU4.
BgeeiQ96IU4.
CleanExiHS_ABHD14B.
GenevestigatoriQ96IU4.

Organism-specific databases

HPAiHPA036444.
HPA036642.

Interactioni

Subunit structurei

May interact with TAF1.

Protein-protein interaction databases

BioGridi124289. 1 interaction.
MINTiMINT-5001888.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi5 – 73
Beta strandi12 – 143
Beta strandi17 – 193
Beta strandi21 – 255
Beta strandi27 – 293
Beta strandi34 – 374
Helixi45 – 517
Helixi53 – 597
Beta strandi63 – 675
Helixi73 – 753
Helixi91 – 10010
Beta strandi106 – 1105
Helixi111 – 1133
Helixi114 – 1218
Beta strandi129 – 1357
Helixi139 – 1413
Helixi144 – 1485
Beta strandi154 – 1596
Helixi163 – 17210
Beta strandi175 – 1839
Helixi190 – 1934
Helixi195 – 20713

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
1IMJX-ray2.20A1-210[»]
ProteinModelPortaliQ96IU4.
SMRiQ96IU4. Positions 2-209.

Miscellaneous databases

EvolutionaryTraceiQ96IU4.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG0596.
HOGENOMiHOG000028065.
HOVERGENiHBG001936.
InParanoidiQ96IU4.
KOiK13706.
OMAiAPICTEK.
OrthoDBiEOG7WDN4H.
PhylomeDBiQ96IU4.
TreeFamiTF314465.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR029059. AB_hydrolase_5.
IPR026764. ABHD14B.
[Graphical view]
PANTHERiPTHR10992:SF281. PTHR10992:SF281. 1 hit.
PfamiPF12695. Abhydrolase_5. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96IU4-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAASVEQREG TIQVQGQALF FREALPGSGQ ARFSVLLLHG IRFSSETWQN    50
LGTLHRLAQA GYRAVAIDLP GLGHSKEAAA PAPIGELAPG SFLAAVVDAL 100
ELGPPVVISP SLSGMYSLPF LTAPGSQLPG FVPVAPICTD KINAANYASV 150
KTPALIVYGD QDPMGQTSFE HLKQLPNHRV LIMKGAGHPC YLDKPEEWHT 200
GLLDFLQGLQ 210
Length:210
Mass (Da):22,346
Last modified:December 1, 2001 - v1
Checksum:i3CACE8759A2ADFAD
GO
Isoform 2 (identifier: Q96IU4-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS

Note: No experimental confirmation available.

Show »
Length:172
Mass (Da):18,046
Checksum:i4C73568207B54B5C
GO

Sequence cautioni

The sequence AAH50650.1 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6969MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2.
VSP_008058Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK075034 mRNA. Translation: BAC11366.1.
AK075112 mRNA. Translation: BAC11408.1.
AK096073 mRNA. Translation: BAC04696.1.
BC007234 mRNA. Translation: AAH07234.1.
BC050650 mRNA. Translation: AAH50650.1. Different initiation.
BC056411 mRNA. Translation: AAH56411.1.
CCDSiCCDS2842.1. [Q96IU4-1]
RefSeqiNP_001139786.1. NM_001146314.1. [Q96IU4-1]
NP_001241682.1. NM_001254753.1. [Q96IU4-2]
NP_116139.1. NM_032750.2. [Q96IU4-1]
UniGeneiHs.420796.

Genome annotation databases

EnsembliENST00000361143; ENSP00000354841; ENSG00000114779. [Q96IU4-1]
ENST00000395008; ENSP00000378455; ENSG00000114779. [Q96IU4-1]
ENST00000483233; ENSP00000420065; ENSG00000114779. [Q96IU4-1]
ENST00000525795; ENSP00000433388; ENSG00000114779. [Q96IU4-1]
GeneIDi84836.
KEGGihsa:84836.
UCSCiuc003dcm.3. human. [Q96IU4-1]
uc021wza.1. human. [Q96IU4-2]

Polymorphism databases

DMDMi34222621.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK075034 mRNA. Translation: BAC11366.1 .
AK075112 mRNA. Translation: BAC11408.1 .
AK096073 mRNA. Translation: BAC04696.1 .
BC007234 mRNA. Translation: AAH07234.1 .
BC050650 mRNA. Translation: AAH50650.1 . Different initiation.
BC056411 mRNA. Translation: AAH56411.1 .
CCDSi CCDS2842.1. [Q96IU4-1 ]
RefSeqi NP_001139786.1. NM_001146314.1. [Q96IU4-1 ]
NP_001241682.1. NM_001254753.1. [Q96IU4-2 ]
NP_116139.1. NM_032750.2. [Q96IU4-1 ]
UniGenei Hs.420796.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
1IMJ X-ray 2.20 A 1-210 [» ]
ProteinModelPortali Q96IU4.
SMRi Q96IU4. Positions 2-209.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124289. 1 interaction.
MINTi MINT-5001888.

Protein family/group databases

MEROPSi S33.983.

PTM databases

PhosphoSitei Q96IU4.

Polymorphism databases

DMDMi 34222621.

2D gel databases

OGPi Q96IU4.
REPRODUCTION-2DPAGE IPI00063827.
SWISS-2DPAGE Q96IU4.

Proteomic databases

MaxQBi Q96IU4.
PaxDbi Q96IU4.
PeptideAtlasi Q96IU4.
PRIDEi Q96IU4.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000361143 ; ENSP00000354841 ; ENSG00000114779 . [Q96IU4-1 ]
ENST00000395008 ; ENSP00000378455 ; ENSG00000114779 . [Q96IU4-1 ]
ENST00000483233 ; ENSP00000420065 ; ENSG00000114779 . [Q96IU4-1 ]
ENST00000525795 ; ENSP00000433388 ; ENSG00000114779 . [Q96IU4-1 ]
GeneIDi 84836.
KEGGi hsa:84836.
UCSCi uc003dcm.3. human. [Q96IU4-1 ]
uc021wza.1. human. [Q96IU4-2 ]

Organism-specific databases

CTDi 84836.
GeneCardsi GC03M052003.
HGNCi HGNC:28235. ABHD14B.
HPAi HPA036444.
HPA036642.
neXtProti NX_Q96IU4.
PharmGKBi PA142672660.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0596.
HOGENOMi HOG000028065.
HOVERGENi HBG001936.
InParanoidi Q96IU4.
KOi K13706.
OMAi APICTEK.
OrthoDBi EOG7WDN4H.
PhylomeDBi Q96IU4.
TreeFami TF314465.

Miscellaneous databases

ChiTaRSi ABHD14B. human.
EvolutionaryTracei Q96IU4.
GenomeRNAii 84836.
NextBioi 75053.
PROi Q96IU4.

Gene expression databases

ArrayExpressi Q96IU4.
Bgeei Q96IU4.
CleanExi HS_ABHD14B.
Genevestigatori Q96IU4.

Family and domain databases

Gene3Di 3.40.50.1820. 1 hit.
InterProi IPR029058. AB_hydrolase.
IPR029059. AB_hydrolase_5.
IPR026764. ABHD14B.
[Graphical view ]
PANTHERi PTHR10992:SF281. PTHR10992:SF281. 1 hit.
Pfami PF12695. Abhydrolase_5. 1 hit.
[Graphical view ]
SUPFAMi SSF53474. SSF53474. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Kidney, Ovarian carcinoma and Placenta.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung and Skin.
  3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  4. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
  5. "Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B."
    Padmanabhan B., Kuzuhara T., Mizuno H., Horikoshi M.
    Acta Crystallogr. D 56:1479-1481(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), INTERACTION WITH TAF1, SUBCELLULAR LOCATION.
  6. "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB)."
    Padmanabhan B., Kuzuhara T., Adachi N., Horikoshi M.
    J. Biol. Chem. 279:9615-9624(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), FUNCTION, ACTIVE SITE, SUBCELLULAR LOCATION, INTERACTION WITH TAF1, TISSUE SPECIFICITY.

Entry informationi

Entry nameiABHEB_HUMAN
AccessioniPrimary (citable) accession number: Q96IU4
Secondary accession number(s): Q86VK8, Q8N8W5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 22, 2003
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 109 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi