Q96IU4 (ABHEB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Alpha/beta hydrolase domain-containing protein 14B Short name=Abhydrolase domain-containing protein 14B EC=3.-.-.- Alternative name(s): CCG1-interacting factor B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 210 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription. Ref.5 |
| Subunit structure | May interact with TAF1. |
| Subcellular location | Cytoplasm. Nucleus. Note: Predominantly cytoplasmic. Ref.4 Ref.5 |
| Tissue specificity | Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney. Ref.5 |
| Sequence similarities | Belongs to the AB hydrolase superfamily. ABHD14 family. |
| Sequence caution | The sequence AAH50650.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleolusInferred from direct assay. Source: HPA |
| Molecular_function | hydrolase activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IU4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IU4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 210 | 210 | Alpha/beta hydrolase domain-containing protein 14B | PRO_0000065038 | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 111 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 162 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 188 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 69 | 69 | MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2. | VSP_008058 | |||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 5 – 7 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 14 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 19 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 21 – 25 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 27 – 29 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 37 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 45 – 51 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 53 – 59 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 63 – 67 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 75 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 91 – 100 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 110 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 121 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 135 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 148 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 159 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 163 – 172 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 183 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 193 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 195 – 207 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Kidney, Ovarian carcinoma and Placenta. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Skin. |
| [3] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [4] | "Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B." Padmanabhan B., Kuzuhara T., Mizuno H., Horikoshi M. Acta Crystallogr. D 56:1479-1481(2000) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), INTERACTION WITH TAF1, SUBCELLULAR LOCATION. |
| [5] | "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB)." Padmanabhan B., Kuzuhara T., Adachi N., Horikoshi M. J. Biol. Chem. 279:9615-9624(2004) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), FUNCTION, ACTIVE SITE, SUBCELLULAR LOCATION, INTERACTION WITH TAF1, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK075034 mRNA. Translation: BAC11366.1. AK075112 mRNA. Translation: BAC11408.1. AK096073 mRNA. Translation: BAC04696.1. BC007234 mRNA. Translation: AAH07234.1. BC050650 mRNA. Translation: AAH50650.1. Different initiation. BC056411 mRNA. Translation: AAH56411.1. | ||||||||||||
| IPI | IPI00063827. IPI00167615. | ||||||||||||
| RefSeq | NP_001139786.1. NM_001146314.1. NP_001241682.1. NM_001254753.1. NP_116139.1. NM_032750.2. | ||||||||||||
| UniGene | Hs.420796. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q96IU4. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein family/group databases | |||||||||||||
| MEROPS | S33.983. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q96IU4. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 34222621. | ||||||||||||
2D gel databases | |||||||||||||
| OGP | Q96IU4. | ||||||||||||
| REPRODUCTION-2DPAGE | IPI00063827. | ||||||||||||
| SWISS-2DPAGE | Q96IU4. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q96IU4. | ||||||||||||
| PeptideAtlas | Q96IU4. | ||||||||||||
| PRIDE | Q96IU4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000361143; ENSP00000354841; ENSG00000114779. ENST00000395008; ENSP00000378455; ENSG00000114779. ENST00000483233; ENSP00000420065; ENSG00000114779. ENST00000525795; ENSP00000433388; ENSG00000114779. | ||||||||||||
| GeneID | 84836. | ||||||||||||
| KEGG | hsa:84836. | ||||||||||||
| UCSC | uc003dcm.3. human. uc021wza.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 84836. | ||||||||||||
| GeneCards | GC03M052003. | ||||||||||||
| HGNC | HGNC:28235. ABHD14B. | ||||||||||||
| HPA | HPA036444. HPA036642. | ||||||||||||
| neXtProt | NX_Q96IU4. | ||||||||||||
| PharmGKB | PA142672660. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0596. | ||||||||||||
| HOGENOM | HOG000028065. | ||||||||||||
| HOVERGEN | HBG001936. | ||||||||||||
| InParanoid | Q96IU4. | ||||||||||||
| KO | K13706. | ||||||||||||
| OMA | NHRVLVM. | ||||||||||||
| OrthoDB | EOG444KMC. | ||||||||||||
| PhylomeDB | Q96IU4. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96IU4. | ||||||||||||
| Bgee | Q96IU4. | ||||||||||||
| CleanEx | HS_ABHD14B. | ||||||||||||
| Genevestigator | Q96IU4. | ||||||||||||
| GermOnline | ENSG00000114779. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR026764. ABHD14B. [Graphical view] | ||||||||||||
| PANTHER | PTHR10992:SF281. PTHR10992:SF281. 1 hit. | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | ABHD14B. human. | ||||||||||||
| EvolutionaryTrace | Q96IU4. | ||||||||||||
| GenomeRNAi | 84836. | ||||||||||||
| NextBio | 75053. | ||||||||||||
Entry information
| Entry name | ABHEB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IU4 Secondary accession number(s): Q86VK8, Q8N8W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
