Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96IU4

- ABHEB_HUMAN

UniProt

Q96IU4 - ABHEB_HUMAN

Protein

Alpha/beta hydrolase domain-containing protein 14B

Gene

ABHD14B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 110 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Active sitei111 – 1111Charge relay systemBy similarity
    Active sitei162 – 1621Charge relay systemBy similarity
    Active sitei188 – 1881Charge relay systemBy similarity

    GO - Molecular functioni

    1. hydrolase activity Source: UniProt
    2. protein binding Source: UniProt

    GO - Biological processi

    1. metabolic process Source: GOC
    2. positive regulation of transcription from RNA polymerase II promoter Source: UniProt

    Keywords - Molecular functioni

    Hydrolase

    Protein family/group databases

    MEROPSiS33.983.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Alpha/beta hydrolase domain-containing protein 14B (EC:3.-.-.-)
    Short name:
    Abhydrolase domain-containing protein 14B
    Alternative name(s):
    CCG1-interacting factor B
    Gene namesi
    Name:ABHD14B
    Synonyms:CIB
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:28235. ABHD14B.

    Subcellular locationi

    Cytoplasm. Nucleus
    Note: Predominantly cytoplasmic.

    GO - Cellular componenti

    1. cytoplasm Source: HPA
    2. cytosol Source: UniProt
    3. extracellular vesicular exosome Source: UniProt
    4. nucleolus Source: HPA
    5. nucleus Source: UniProt

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672660.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Initiator methioninei1 – 11Removed1 Publication
    Chaini2 – 210209Alpha/beta hydrolase domain-containing protein 14BPRO_0000065038Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei2 – 21N-acetylalanine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ96IU4.
    PaxDbiQ96IU4.
    PeptideAtlasiQ96IU4.
    PRIDEiQ96IU4.

    2D gel databases

    OGPiQ96IU4.
    REPRODUCTION-2DPAGEIPI00063827.
    SWISS-2DPAGEQ96IU4.

    PTM databases

    PhosphoSiteiQ96IU4.

    Expressioni

    Tissue specificityi

    Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ96IU4.
    BgeeiQ96IU4.
    CleanExiHS_ABHD14B.
    GenevestigatoriQ96IU4.

    Organism-specific databases

    HPAiHPA036444.
    HPA036642.

    Interactioni

    Subunit structurei

    May interact with TAF1.

    Protein-protein interaction databases

    BioGridi124289. 1 interaction.
    MINTiMINT-5001888.

    Structurei

    Secondary structure

    1
    210
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi5 – 73
    Beta strandi12 – 143
    Beta strandi17 – 193
    Beta strandi21 – 255
    Beta strandi27 – 293
    Beta strandi34 – 374
    Helixi45 – 517
    Helixi53 – 597
    Beta strandi63 – 675
    Helixi73 – 753
    Helixi91 – 10010
    Beta strandi106 – 1105
    Helixi111 – 1133
    Helixi114 – 1218
    Beta strandi129 – 1357
    Helixi139 – 1413
    Helixi144 – 1485
    Beta strandi154 – 1596
    Helixi163 – 17210
    Beta strandi175 – 1839
    Helixi190 – 1934
    Helixi195 – 20713

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    1IMJX-ray2.20A1-210[»]
    ProteinModelPortaliQ96IU4.
    SMRiQ96IU4. Positions 2-209.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96IU4.

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the AB hydrolase superfamily. ABHD14 family.Curated

    Phylogenomic databases

    eggNOGiCOG0596.
    HOGENOMiHOG000028065.
    HOVERGENiHBG001936.
    InParanoidiQ96IU4.
    KOiK13706.
    OMAiAPICTEK.
    OrthoDBiEOG7WDN4H.
    PhylomeDBiQ96IU4.
    TreeFamiTF314465.

    Family and domain databases

    Gene3Di3.40.50.1820. 1 hit.
    InterProiIPR029058. AB_hydrolase.
    IPR029059. AB_hydrolase_5.
    IPR026764. ABHD14B.
    [Graphical view]
    PANTHERiPTHR10992:SF281. PTHR10992:SF281. 1 hit.
    PfamiPF12695. Abhydrolase_5. 1 hit.
    [Graphical view]
    SUPFAMiSSF53474. SSF53474. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96IU4-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAASVEQREG TIQVQGQALF FREALPGSGQ ARFSVLLLHG IRFSSETWQN    50
    LGTLHRLAQA GYRAVAIDLP GLGHSKEAAA PAPIGELAPG SFLAAVVDAL 100
    ELGPPVVISP SLSGMYSLPF LTAPGSQLPG FVPVAPICTD KINAANYASV 150
    KTPALIVYGD QDPMGQTSFE HLKQLPNHRV LIMKGAGHPC YLDKPEEWHT 200
    GLLDFLQGLQ 210
    Length:210
    Mass (Da):22,346
    Last modified:December 1, 2001 - v1
    Checksum:i3CACE8759A2ADFAD
    GO
    Isoform 2 (identifier: Q96IU4-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS

    Note: No experimental confirmation available.

    Show »
    Length:172
    Mass (Da):18,046
    Checksum:i4C73568207B54B5C
    GO

    Sequence cautioni

    The sequence AAH50650.1 differs from that shown. Reason: Erroneous initiation.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6969MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2. 1 PublicationVSP_008058Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK075034 mRNA. Translation: BAC11366.1.
    AK075112 mRNA. Translation: BAC11408.1.
    AK096073 mRNA. Translation: BAC04696.1.
    BC007234 mRNA. Translation: AAH07234.1.
    BC050650 mRNA. Translation: AAH50650.1. Different initiation.
    BC056411 mRNA. Translation: AAH56411.1.
    CCDSiCCDS2842.1. [Q96IU4-1]
    RefSeqiNP_001139786.1. NM_001146314.1. [Q96IU4-1]
    NP_001241682.1. NM_001254753.1. [Q96IU4-2]
    NP_116139.1. NM_032750.2. [Q96IU4-1]
    UniGeneiHs.420796.

    Genome annotation databases

    EnsembliENST00000361143; ENSP00000354841; ENSG00000114779. [Q96IU4-1]
    ENST00000395008; ENSP00000378455; ENSG00000114779. [Q96IU4-1]
    ENST00000483233; ENSP00000420065; ENSG00000114779. [Q96IU4-1]
    ENST00000525795; ENSP00000433388; ENSG00000114779. [Q96IU4-1]
    GeneIDi84836.
    KEGGihsa:84836.
    UCSCiuc003dcm.3. human. [Q96IU4-1]
    uc021wza.1. human. [Q96IU4-2]

    Polymorphism databases

    DMDMi34222621.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK075034 mRNA. Translation: BAC11366.1 .
    AK075112 mRNA. Translation: BAC11408.1 .
    AK096073 mRNA. Translation: BAC04696.1 .
    BC007234 mRNA. Translation: AAH07234.1 .
    BC050650 mRNA. Translation: AAH50650.1 . Different initiation.
    BC056411 mRNA. Translation: AAH56411.1 .
    CCDSi CCDS2842.1. [Q96IU4-1 ]
    RefSeqi NP_001139786.1. NM_001146314.1. [Q96IU4-1 ]
    NP_001241682.1. NM_001254753.1. [Q96IU4-2 ]
    NP_116139.1. NM_032750.2. [Q96IU4-1 ]
    UniGenei Hs.420796.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    1IMJ X-ray 2.20 A 1-210 [» ]
    ProteinModelPortali Q96IU4.
    SMRi Q96IU4. Positions 2-209.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124289. 1 interaction.
    MINTi MINT-5001888.

    Protein family/group databases

    MEROPSi S33.983.

    PTM databases

    PhosphoSitei Q96IU4.

    Polymorphism databases

    DMDMi 34222621.

    2D gel databases

    OGPi Q96IU4.
    REPRODUCTION-2DPAGE IPI00063827.
    SWISS-2DPAGE Q96IU4.

    Proteomic databases

    MaxQBi Q96IU4.
    PaxDbi Q96IU4.
    PeptideAtlasi Q96IU4.
    PRIDEi Q96IU4.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000361143 ; ENSP00000354841 ; ENSG00000114779 . [Q96IU4-1 ]
    ENST00000395008 ; ENSP00000378455 ; ENSG00000114779 . [Q96IU4-1 ]
    ENST00000483233 ; ENSP00000420065 ; ENSG00000114779 . [Q96IU4-1 ]
    ENST00000525795 ; ENSP00000433388 ; ENSG00000114779 . [Q96IU4-1 ]
    GeneIDi 84836.
    KEGGi hsa:84836.
    UCSCi uc003dcm.3. human. [Q96IU4-1 ]
    uc021wza.1. human. [Q96IU4-2 ]

    Organism-specific databases

    CTDi 84836.
    GeneCardsi GC03M052003.
    HGNCi HGNC:28235. ABHD14B.
    HPAi HPA036444.
    HPA036642.
    neXtProti NX_Q96IU4.
    PharmGKBi PA142672660.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0596.
    HOGENOMi HOG000028065.
    HOVERGENi HBG001936.
    InParanoidi Q96IU4.
    KOi K13706.
    OMAi APICTEK.
    OrthoDBi EOG7WDN4H.
    PhylomeDBi Q96IU4.
    TreeFami TF314465.

    Miscellaneous databases

    ChiTaRSi ABHD14B. human.
    EvolutionaryTracei Q96IU4.
    GenomeRNAii 84836.
    NextBioi 75053.
    PROi Q96IU4.

    Gene expression databases

    ArrayExpressi Q96IU4.
    Bgeei Q96IU4.
    CleanExi HS_ABHD14B.
    Genevestigatori Q96IU4.

    Family and domain databases

    Gene3Di 3.40.50.1820. 1 hit.
    InterProi IPR029058. AB_hydrolase.
    IPR029059. AB_hydrolase_5.
    IPR026764. ABHD14B.
    [Graphical view ]
    PANTHERi PTHR10992:SF281. PTHR10992:SF281. 1 hit.
    Pfami PF12695. Abhydrolase_5. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53474. SSF53474. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Kidney, Ovarian carcinoma and Placenta.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung and Skin.
    3. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    4. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS], CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS].
    5. "Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B."
      Padmanabhan B., Kuzuhara T., Mizuno H., Horikoshi M.
      Acta Crystallogr. D 56:1479-1481(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), INTERACTION WITH TAF1, SUBCELLULAR LOCATION.
    6. "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB)."
      Padmanabhan B., Kuzuhara T., Adachi N., Horikoshi M.
      J. Biol. Chem. 279:9615-9624(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), FUNCTION, ACTIVE SITE, SUBCELLULAR LOCATION, INTERACTION WITH TAF1, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiABHEB_HUMAN
    AccessioniPrimary (citable) accession number: Q96IU4
    Secondary accession number(s): Q86VK8, Q8N8W5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 22, 2003
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 110 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3