Reviewed,
UniProtKB/Swiss-Prot Q96IU4 (ABHEB_HUMAN)
Last modified
December 15, 2009.
Version 67.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Abhydrolase domain-containing protein 14B EC=3.-.-.- Alternative name(s): CCG1-interacting factor B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 210 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription. Ref.6 |
| Subunit structure | May interact with TAF1. |
| Subcellular location | Cytoplasm. Nucleus. Note: Predominantly cytoplasmic. Ref.6 Ref.5 |
| Tissue specificity | Ubiquitous. Detected in spleen, thymus, prostate, testis, ovary, small intestine, colon, peripheral blood leukocyte, heart, placenta, lung, liver, skeletal muscle, pancreas and kidney. Ref.6 |
| Sequence similarities | Belongs to the AB hydrolase superfamily. ABHD14 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Molecular function | Hydrolase |
| PTM | Acetylation |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | hydrolase activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IU4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IU4-2) The sequence of this isoform differs from the canonical sequence as follows: 1-69: MAASVEQREG...AGYRAVAIDL → MGPGLFPAFLLRPQVTASTRLLPVCASPRSS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed | ||||||||||||||||||||||||||||||||||||||||||||||||
| Chain | 2 – 210 | 209 | Abhydrolase domain-containing protein 14B | PRO_0000065038 | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 111 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 162 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 188 | 1 | Charge relay system By similarity | ||||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine | ||||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 69 | 69 | MAASV…VAIDL → MGPGLFPAFLLRPQVTASTR LLPVCASPRSS in isoform 2. | VSP_008058 | |||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 5 – 7 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 12 – 14 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 19 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 21 – 25 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 27 – 29 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 34 – 37 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 45 – 51 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 53 – 59 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 63 – 67 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 73 – 75 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 91 – 100 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 106 – 110 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 111 – 113 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 114 – 121 | 8 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 129 – 135 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 139 – 141 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 144 – 148 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 154 – 159 | 6 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 163 – 172 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 175 – 183 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 190 – 193 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 195 – 207 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Kidney, Ovarian carcinoma and Placenta. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung and Skin. |
| [3] | Colinge J., Superti-Furga G., Bennett K.L. Submitted (OCT-2008) to UniProtKB Cited for: IDENTIFICATION [LARGE SCALE ANALYSIS], MASS SPECTROMETRY. |
| [4] | "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach." Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S. Anal. Chem. 81:4493-4501(2009) [PubMed: 19413330] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, MASS SPECTROMETRY. |
| [5] | "Purification, crystallization and preliminary X-ray crystallographic analysis of human CCG1-interacting factor B." Padmanabhan B., Kuzuhara T., Mizuno H., Horikoshi M. Acta Crystallogr. D 56:1479-1481(2000) [PubMed: 11053859] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), INTERACTION WITH TAF1, SUBCELLULAR LOCATION. |
| [6] | "The crystal structure of CCG1/TAF(II)250-interacting factor B (CIB)." Padmanabhan B., Kuzuhara T., Adachi N., Horikoshi M. J. Biol. Chem. 279:9615-9624(2004) [PubMed: 14672934] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS), FUNCTION, ACTIVE SITE, SUBCELLULAR LOCATION, INTERACTION WITH TAF1, TISSUE SPECIFICITY. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AK075034 mRNA. Translation: BAC11366.1. AK075112 mRNA. Translation: BAC11408.1. AK096073 mRNA. Translation: BAC04696.1. BC007234 mRNA. Translation: AAH07234.1. BC050650 mRNA. Translation: AAH50650.1. Different initiation. BC056411 mRNA. Translation: AAH56411.1. | |||||||||||||
| IPI | IPI00063827. IPI00167615. | ||||||||||||
| RefSeq | NP_001139786.1. NP_116139.1. | ||||||||||||
| UniGene | Hs.420796 Hs.534400 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein family/group databases | |||||||||||||
| MEROPS | S33.983. | ||||||||||||
2-D gel databases | |||||||||||||
| SWISS-2DPAGE | Q96IU4. | ||||||||||||
| OGP | Q96IU4. | ||||||||||||
| REPRODUCTION-2DPAGE | IPI00063827. | ||||||||||||
Proteomic databases | |||||||||||||
| PeptideAtlas | Q96IU4. | ||||||||||||
| PRIDE | Q96IU4. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000361143; ENSP00000354841; ENSG00000114779; Homo sapiens. [Genome view] ENST00000395008; ENSP00000378455; ENSG00000114779; Homo sapiens. [Genome view] ENST00000483233; ENSP00000420065; ENSG00000114779; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 84836. | ||||||||||||
| KEGG | hsa:84836. | ||||||||||||
| UCSC | uc003dcm.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 84836. | ||||||||||||
| GeneCards | GC03M051978. | ||||||||||||
| H-InvDB | HIX0003339. | ||||||||||||
| HGNC | HGNC:28235. ABHD14B. | ||||||||||||
| PharmGKB | PA142672660. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | HBG727630. | ||||||||||||
| HOVERGEN | Q96IU4. | ||||||||||||
| InParanoid | Q96IU4. | ||||||||||||
| OMA | NHRVLVM. | ||||||||||||
| OrthoDB | EOG98KTX0. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96IU4. | ||||||||||||
| Bgee | Q96IU4. | ||||||||||||
| CleanEx | HS_ABHD14B. | ||||||||||||
| Genevestigator | Q96IU4. | ||||||||||||
| GermOnline | ENSG00000114779. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 75053. | ||||||||||||
Entry information
| Entry name | ABHEB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IU4 Secondary accession number(s): Q86VK8, Q8N8W5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


