Q96IT1 (ZN496_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 80.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc finger protein 496 Alternative name(s): Zinc finger protein with KRAB and SCAN domains 17 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 587 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | DNA-binding transcription factor that can both act as an activator and a repressor By similarity. |
| Subunit structure | Interacts (via zinc-fingers) with JARID2. Interacts with NSD1 By similarity. |
| Subcellular location | Nucleus By similarity. |
| Domain | The C2H2-type zinc finger 1, also named C2HR, mediates the interaction with NSD1 By similarity. |
| Sequence similarities | Belongs to the krueppel C2H2-type zinc-finger protein family. Contains 5 C2H2-type zinc fingers. Contains 1 KRAB domain. Contains 1 SCAN box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Zinc-finger |
| Ligand | DNA-binding Metal-binding Zinc |
| Molecular function | Activator Repressor |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | positive regulation of transcription, DNA-dependent Inferred from sequence or structural similarity. Source: UniProtKB transcription, DNA-dependentInferred from electronic annotation. Source: UniProtKB-KW viral reproductionInferred from electronic annotation. Source: InterPro |
| Molecular function | DNA binding Inferred from sequence or structural similarity. Source: UniProtKB sequence-specific DNA binding transcription factor activityInferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ARR3 | P36575 | 2 | EBI-743906,EBI-718116 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IT1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IT1-2) The sequence of this isoform differs from the canonical sequence as follows: 217-217: P → PRIFQFNNHRSNGYILEMLGSGGKKAQIISVLSQIYV | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 587 | 587 | Zinc finger protein 496 | PRO_0000047617 | |||||
Regions | |||||||||
| Domain | 42 – 124 | 83 | SCAN box | ||||||
| Domain | 221 – 291 | 71 | KRAB | ||||||
| Zinc finger | 406 – 428 | 23 | C2H2-type 1; degenerate | ||||||
| Zinc finger | 435 – 457 | 23 | C2H2-type 2 | ||||||
| Zinc finger | 463 – 485 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 522 – 545 | 24 | C2H2-type 4 | ||||||
| Zinc finger | 553 – 575 | 23 | C2H2-type 5 | ||||||
Amino acid modifications | |||||||||
| Modified residue | 185 | 1 | Phosphoserine Ref.3 | ||||||
| Modified residue | 299 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 217 | 1 | P → PRIFQFNNHRSNGYILEMLG SGGKKAQIISVLSQIYV in isoform 2. | VSP_038755 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed: 16710414] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 112-587 (ISOFORM 2). Tissue: Colon and Lung. |
| [3] | "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis." Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III J. Proteome Res. 7:1346-1351(2008) [PubMed: 18220336] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-185, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [4] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed: 19690332] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AC104335 Genomic DNA. No translation available. BC007263 mRNA. Translation: AAH07263.1. BC025794 mRNA. Translation: AAH25794.1. |
| IPI | IPI00063800. IPI00152251. |
| RefSeq | NP_116141.1. NM_032752.1. |
| UniGene | Hs.654803. |
3D structure databases | |
| ProteinModelPortal | Q96IT1. |
| SMR | Q96IT1. Positions 36-123, 216-269, 311-584. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96IT1. 2 interactions. |
| MINT | MINT-1456018. |
| STRING | Q96IT1. |
PTM databases | |
| PhosphoSite | Q96IT1. |
Polymorphism databases | |
| DMDM | 55976755. |
Proteomic databases | |
| PRIDE | Q96IT1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000294753; ENSP00000294753; ENSG00000162714. |
| GeneID | 84838. |
| KEGG | hsa:84838. |
| UCSC | uc001ico.1. human. |
Organism-specific databases | |
| CTD | 84838. |
| GeneCards | GC01M247460. |
| HGNC | HGNC:23713. ZNF496. |
| MIM | 613911. gene. |
| neXtProt | NX_Q96IT1. |
| PharmGKB | PA134888470. |
| GenAtlas | Search... |
Phylogenomic databases | |
| GeneTree | ENSGT00590000082911. |
| HOVERGEN | HBG058089. |
| OrthoDB | EOG4FBHSF. |
| PhylomeDB | Q96IT1. |
Enzyme and pathway databases | |
| Reactome | REACT_71. Gene Expression. |
Gene expression databases | |
| ArrayExpress | Q96IT1. |
| Bgee | Q96IT1. |
| CleanEx | HS_ZNF496. |
| Genevestigator | Q96IT1. |
| GermOnline | ENSG00000162714. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR001909. Krueppel-associated_box. IPR008916. Retrov_capsid_C. IPR003309. Tscrpt_reg_SCAN. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:3.30.160.60. Znf_C2H2/integrase_DNA-bd. 5 hits. |
| KO | K09229. |
| Pfam | PF01352. KRAB. 1 hit. PF02023. SCAN. 1 hit. PF00096. zf-C2H2. 5 hits. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. SM00431. SCAN. 1 hit. SM00355. ZnF_C2H2. 5 hits. [Graphical view] |
| SUPFAM | SSF109640. Krueppel-associated_box. 1 hit. SSF47353. Retrov_capsid_C. 1 hit. |
| PROSITE | PS50805. KRAB. 1 hit. PS50804. SCAN_BOX. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 4 hits. PS50157. ZINC_FINGER_C2H2_2. 5 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 75061. |
| SOURCE | Search... |
Entry information
| Entry name | ZN496_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IT1 Secondary accession number(s): Q8TBS2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with