Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 496

Gene

ZNF496

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

DNA-binding transcription factor that can both act as an activator and a repressor.By similarity

Caution

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri406 – 428C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri435 – 457C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri463 – 485C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri522 – 545C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri553 – 575C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionActivator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 496
Alternative name(s):
Zinc finger protein with KRAB and SCAN domains 17
Gene namesi
Name:ZNF496
Synonyms:ZKSCAN17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

EuPathDBiHostDB:ENSG00000162714.12
HGNCiHGNC:23713 ZNF496
MIMi613911 gene
neXtProtiNX_Q96IT1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000162714
PharmGKBiPA134888470

Polymorphism and mutation databases

BioMutaiZNF496
DMDMi55976755

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000476171 – 587Zinc finger protein 496Add BLAST587

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki13Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei185PhosphoserineCombined sources1
Modified residuei299PhosphoserineCombined sources1
Cross-linki403Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki496Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ96IT1
PaxDbiQ96IT1
PeptideAtlasiQ96IT1
PRIDEiQ96IT1

PTM databases

iPTMnetiQ96IT1
PhosphoSitePlusiQ96IT1

Expressioni

Gene expression databases

BgeeiENSG00000162714
CleanExiHS_ZNF496
ExpressionAtlasiQ96IT1 baseline and differential
GenevisibleiQ96IT1 HS

Organism-specific databases

HPAiHPA055834

Interactioni

Subunit structurei

Interacts (via zinc-fingers) with JARID2. Interacts with NSD1 (By similarity).By similarity

Binary interactionsi

Show more details

GO - Molecular functioni

Protein-protein interaction databases

BioGridi12429138 interactors.
IntActiQ96IT1 13 interactors.
STRINGi9606.ENSP00000294753

Structurei

3D structure databases

ProteinModelPortaliQ96IT1
SMRiQ96IT1
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini42 – 124SCAN boxPROSITE-ProRule annotationAdd BLAST83
Domaini221 – 291KRABPROSITE-ProRule annotationAdd BLAST71

Domaini

The C2H2-type zinc finger 1, also named C2HR, mediates the interaction with NSD1.By similarity

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri406 – 428C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri435 – 457C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri463 – 485C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri522 – 545C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri553 – 575C2H2-type 5PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
COG5048 LUCA
GeneTreeiENSGT00910000144000
HOGENOMiHOG000234619
HOVERGENiHBG058089
InParanoidiQ96IT1
KOiK09229
OMAiGRPWQWL
OrthoDBiEOG091G06AC
PhylomeDBiQ96IT1
TreeFamiTF350829

Family and domain databases

CDDicd07765 KRAB_A-box, 1 hit
cd07936 SCAN, 1 hit
Gene3Di1.10.4020.101 hit
InterProiView protein in InterPro
IPR001909 KRAB
IPR036051 KRAB_dom_sf
IPR003309 SCAN_dom
IPR038269 SCAN_sf
IPR027767 Zfp496
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PANTHERiPTHR45016:SF2 PTHR45016:SF2, 1 hit
PfamiView protein in Pfam
PF01352 KRAB, 1 hit
PF02023 SCAN, 1 hit
SMARTiView protein in SMART
SM00431 SCAN, 1 hit
SM00355 ZnF_C2H2, 5 hits
SUPFAMiSSF109640 SSF109640, 1 hit
SSF57667 SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS50804 SCAN_BOX, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 4 hits
PS50157 ZINC_FINGER_C2H2_2, 5 hits

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPTALCPRVL APKESEEPRK MRSPPGENPS PQGELPSPES SRRLFRRFRY
60 70 80 90 100
QEAAGPREAL QRLWDLCGGW LRPERHTKEQ ILELLVLEQF LAILPREIQS
110 120 130 140 150
WVRAQEPESG EQAVAAVEAL EREPGRPWQW LKHCEDPVVI DDGDSPLDQE
160 170 180 190 200
QEQLPVEPHS DLAKNQDAQP ITLAQCLGLP SRPPSQLSGD PVLQDAFLLQ
210 220 230 240 250
EENVRDTQQV TTLQLPPSRV SPFKDMILCF SEEDWSLLDP AQTGFYGEFI
260 270 280 290 300
IGEDYGVSMP PNDLAAQPDL SQGEENEPRV PELQDLQGKE VPQVSYLDSP
310 320 330 340 350
SLQPFQVEER RKREELQVPE FQACPQTVVP QNTYPAGGNP RSLENSLDEE
360 370 380 390 400
VTIEIVLSSS GDEDSQHGPY CTEELGSPTE KQRSLPASHR SSTEAGGEVQ
410 420 430 440 450
TSKKSYVCPN CGKIFRWRVN FIRHLRSRRE QEKPHECSVC GELFSDSEDL
460 470 480 490 500
DGHLESHEAQ KPYRCGACGK SFRLNSHLLS HRRIHLQPDR LQPVEKREQA
510 520 530 540 550
ASEDADKGPK EPLENGKAKL SFQCCECGKA FQRHDHLARH RSHFHLKDKA
560 570 580
RPFQCRYCVK SFTQNYDLLR HERLHMKRRS KQALNSY
Length:587
Mass (Da):66,908
Last modified:December 1, 2001 - v1
Checksum:i72A4F4D5CD309013
GO
Isoform 2 (identifier: Q96IT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-217: P → PRIFQFNNHRSNGYILEMLGSGGKKAQIISVLSQIYV

Note: No experimental confirmation available.
Show »
Length:623
Mass (Da):70,973
Checksum:iDF5166381C72A355
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_038755217P → PRIFQFNNHRSNGYILEMLG SGGKKAQIISVLSQIYV in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC104335 Genomic DNA No translation available.
BC007263 mRNA Translation: AAH07263.1
BC025794 mRNA Translation: AAH25794.1
CCDSiCCDS1631.1 [Q96IT1-1]
RefSeqiNP_116141.1, NM_032752.2 [Q96IT1-1]
XP_005273385.1, XM_005273328.3 [Q96IT1-2]
UniGeneiHs.168677
Hs.654803

Genome annotation databases

EnsembliENST00000294753; ENSP00000294753; ENSG00000162714 [Q96IT1-1]
GeneIDi84838
KEGGihsa:84838
UCSCiuc001ico.4 human [Q96IT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiZN496_HUMAN
AccessioniPrimary (citable) accession number: Q96IT1
Secondary accession number(s): Q8TBS2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: December 1, 2001
Last modified: March 28, 2018
This is version 140 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome