Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 496

Gene

ZNF496

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

DNA-binding transcription factor that can both act as an activator and a repressor.By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri406 – 42823C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri435 – 45723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri463 – 48523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri522 – 54524C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri553 – 57523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Activator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 496
Alternative name(s):
Zinc finger protein with KRAB and SCAN domains 17
Gene namesi
Name:ZNF496
Synonyms:ZKSCAN17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:23713. ZNF496.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134888470.

Polymorphism and mutation databases

BioMutaiZNF496.
DMDMi55976755.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 587587Zinc finger protein 496PRO_0000047617Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei185 – 1851PhosphoserineCombined sources
Modified residuei299 – 2991PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96IT1.
MaxQBiQ96IT1.
PaxDbiQ96IT1.
PRIDEiQ96IT1.

PTM databases

iPTMnetiQ96IT1.
PhosphoSiteiQ96IT1.

Expressioni

Gene expression databases

BgeeiQ96IT1.
CleanExiHS_ZNF496.
ExpressionAtlasiQ96IT1. baseline and differential.
GenevisibleiQ96IT1. HS.

Organism-specific databases

HPAiHPA052024.
HPA055834.

Interactioni

Subunit structurei

Interacts (via zinc-fingers) with JARID2. Interacts with NSD1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
ARR3P365755EBI-743906,EBI-718116
ZKSCAN4Q969J23EBI-743906,EBI-2818641
ZNF446Q96AF54EBI-743906,EBI-740232
ZNF483Q6P0883EBI-743906,EBI-10196963
ZSCAN12O433093EBI-743906,EBI-1210440
ZSCAN21Q9Y5A63EBI-743906,EBI-10281938
ZSCAN22P100733EBI-743906,EBI-10178224

Protein-protein interaction databases

BioGridi124291. 33 interactions.
IntActiQ96IT1. 7 interactions.
MINTiMINT-1456018.
STRINGi9606.ENSP00000294753.

Structurei

3D structure databases

ProteinModelPortaliQ96IT1.
SMRiQ96IT1. Positions 36-123, 369-582.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini42 – 12483SCAN boxPROSITE-ProRule annotationAdd
BLAST
Domaini221 – 29171KRABPROSITE-ProRule annotationAdd
BLAST

Domaini

The C2H2-type zinc finger 1, also named C2HR, mediates the interaction with NSD1.By similarity

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation
Contains 1 KRAB domain.PROSITE-ProRule annotation
Contains 1 SCAN box domain.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri406 – 42823C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri435 – 45723C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri463 – 48523C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri522 – 54524C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri553 – 57523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129746.
HOGENOMiHOG000234619.
HOVERGENiHBG058089.
InParanoidiQ96IT1.
KOiK09229.
OMAiRIHLQPD.
OrthoDBiEOG71CFKS.
PhylomeDBiQ96IT1.
TreeFamiTF350829.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR027767. Zfp496.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 2 hits.
PTHR10032:SF212. PTHR10032:SF212. 2 hits.
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96IT1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPTALCPRVL APKESEEPRK MRSPPGENPS PQGELPSPES SRRLFRRFRY
60 70 80 90 100
QEAAGPREAL QRLWDLCGGW LRPERHTKEQ ILELLVLEQF LAILPREIQS
110 120 130 140 150
WVRAQEPESG EQAVAAVEAL EREPGRPWQW LKHCEDPVVI DDGDSPLDQE
160 170 180 190 200
QEQLPVEPHS DLAKNQDAQP ITLAQCLGLP SRPPSQLSGD PVLQDAFLLQ
210 220 230 240 250
EENVRDTQQV TTLQLPPSRV SPFKDMILCF SEEDWSLLDP AQTGFYGEFI
260 270 280 290 300
IGEDYGVSMP PNDLAAQPDL SQGEENEPRV PELQDLQGKE VPQVSYLDSP
310 320 330 340 350
SLQPFQVEER RKREELQVPE FQACPQTVVP QNTYPAGGNP RSLENSLDEE
360 370 380 390 400
VTIEIVLSSS GDEDSQHGPY CTEELGSPTE KQRSLPASHR SSTEAGGEVQ
410 420 430 440 450
TSKKSYVCPN CGKIFRWRVN FIRHLRSRRE QEKPHECSVC GELFSDSEDL
460 470 480 490 500
DGHLESHEAQ KPYRCGACGK SFRLNSHLLS HRRIHLQPDR LQPVEKREQA
510 520 530 540 550
ASEDADKGPK EPLENGKAKL SFQCCECGKA FQRHDHLARH RSHFHLKDKA
560 570 580
RPFQCRYCVK SFTQNYDLLR HERLHMKRRS KQALNSY
Length:587
Mass (Da):66,908
Last modified:December 1, 2001 - v1
Checksum:i72A4F4D5CD309013
GO
Isoform 2 (identifier: Q96IT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     217-217: P → PRIFQFNNHRSNGYILEMLGSGGKKAQIISVLSQIYV

Note: No experimental confirmation available.
Show »
Length:623
Mass (Da):70,973
Checksum:iDF5166381C72A355
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei217 – 2171P → PRIFQFNNHRSNGYILEMLG SGGKKAQIISVLSQIYV in isoform 2. 1 PublicationVSP_038755

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC104335 Genomic DNA. No translation available.
BC007263 mRNA. Translation: AAH07263.1.
BC025794 mRNA. Translation: AAH25794.1.
CCDSiCCDS1631.1. [Q96IT1-1]
RefSeqiNP_116141.1. NM_032752.1. [Q96IT1-1]
XP_005273385.1. XM_005273328.3. [Q96IT1-2]
XP_005273387.1. XM_005273330.3. [Q96IT1-1]
UniGeneiHs.654803.

Genome annotation databases

EnsembliENST00000294753; ENSP00000294753; ENSG00000162714. [Q96IT1-1]
GeneIDi84838.
KEGGihsa:84838.
UCSCiuc001ico.4. human. [Q96IT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC104335 Genomic DNA. No translation available.
BC007263 mRNA. Translation: AAH07263.1.
BC025794 mRNA. Translation: AAH25794.1.
CCDSiCCDS1631.1. [Q96IT1-1]
RefSeqiNP_116141.1. NM_032752.1. [Q96IT1-1]
XP_005273385.1. XM_005273328.3. [Q96IT1-2]
XP_005273387.1. XM_005273330.3. [Q96IT1-1]
UniGeneiHs.654803.

3D structure databases

ProteinModelPortaliQ96IT1.
SMRiQ96IT1. Positions 36-123, 369-582.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124291. 33 interactions.
IntActiQ96IT1. 7 interactions.
MINTiMINT-1456018.
STRINGi9606.ENSP00000294753.

PTM databases

iPTMnetiQ96IT1.
PhosphoSiteiQ96IT1.

Polymorphism and mutation databases

BioMutaiZNF496.
DMDMi55976755.

Proteomic databases

EPDiQ96IT1.
MaxQBiQ96IT1.
PaxDbiQ96IT1.
PRIDEiQ96IT1.

Protocols and materials databases

DNASUi84838.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000294753; ENSP00000294753; ENSG00000162714. [Q96IT1-1]
GeneIDi84838.
KEGGihsa:84838.
UCSCiuc001ico.4. human. [Q96IT1-1]

Organism-specific databases

CTDi84838.
GeneCardsiZNF496.
HGNCiHGNC:23713. ZNF496.
HPAiHPA052024.
HPA055834.
MIMi613911. gene.
neXtProtiNX_Q96IT1.
PharmGKBiPA134888470.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129746.
HOGENOMiHOG000234619.
HOVERGENiHBG058089.
InParanoidiQ96IT1.
KOiK09229.
OMAiRIHLQPD.
OrthoDBiEOG71CFKS.
PhylomeDBiQ96IT1.
TreeFamiTF350829.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

ChiTaRSiZNF496. human.
GenomeRNAii84838.
NextBioi75061.
PROiQ96IT1.
SOURCEiSearch...

Gene expression databases

BgeeiQ96IT1.
CleanExiHS_ZNF496.
ExpressionAtlasiQ96IT1. baseline and differential.
GenevisibleiQ96IT1. HS.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR027775. C2H2_Znf_fam.
IPR001909. KRAB.
IPR008916. Retrov_capsid_C.
IPR003309. SCAN_dom.
IPR027767. Zfp496.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PANTHERiPTHR10032. PTHR10032. 2 hits.
PTHR10032:SF212. PTHR10032:SF212. 2 hits.
PfamiPF01352. KRAB. 1 hit.
PF02023. SCAN. 1 hit.
[Graphical view]
SMARTiSM00431. SCAN. 1 hit.
SM00355. ZnF_C2H2. 5 hits.
[Graphical view]
SUPFAMiSSF109640. SSF109640. 1 hit.
SSF47353. SSF47353. 1 hit.
PROSITEiPS50805. KRAB. 1 hit.
PS50804. SCAN_BOX. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 4 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 112-587 (ISOFORM 2).
    Tissue: Colon and Lung.
  3. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-185, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  4. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-299, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.

Entry informationi

Entry nameiZN496_HUMAN
AccessioniPrimary (citable) accession number: Q96IT1
Secondary accession number(s): Q8TBS2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: December 1, 2001
Last modified: May 11, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.