Q96IJ6 (GMPPA_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mannose-1-phosphate guanyltransferase alpha EC=2.7.7.13 Alternative name(s): GDP-mannose pyrophosphorylase A GTP-mannose-1-phosphate guanylyltransferase alpha | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 420 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Catalytic activity | GTP + alpha-D-mannose 1-phosphate = diphosphate + GDP-mannose. |
| Pathway | |
| Sequence similarities | Belongs to the transferase hexapeptide repeat family. |
| Sequence caution | The sequence AAD38517.1 differs from that shown. Reason: Frameshift at position 355. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | GTP-binding Nucleotide-binding |
| Molecular function | Nucleotidyltransferase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | GDP-mannose biosynthetic process Traceable author statement. Source: Reactome dolichol-linked oligosaccharide biosynthetic processTraceable author statement. Source: Reactome post-translational protein modificationTraceable author statement. Source: Reactome protein N-linked glycosylation via asparagineTraceable author statement. Source: Reactome |
| Molecular function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW mannose-1-phosphate guanylyltransferase activityInferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96IJ6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96IJ6-2) The sequence of this isoform differs from the canonical sequence as follows: 285-285: G → GTQPAPIPNLWLPPQPSEPGFLTSSPELKPQSLPLPDQIRFGIFAPRASLLLLG |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 420 | 420 | Mannose-1-phosphate guanyltransferase alpha | PRO_0000327872 | |||||
Natural variations | |||||||||
| Alternative sequence | 285 | 1 | G → GTQPAPIPNLWLPPQPSEPG FLTSSPELKPQSLPLPDQIR FGIFAPRASLLLLG in isoform 2. | VSP_032741 | |||||
| Natural variant | 21 | 1 | S → F. Corresponds to variant rs34218609 [ dbSNP | Ensembl ]. | VAR_042434 | |||||
| Natural variant | 156 | 1 | V → A. Corresponds to variant rs13396066 [ dbSNP | Ensembl ]. | VAR_042435 | |||||
Experimental info | |||||||||
| Sequence conflict | 57 | 1 | G → C in BAD96671. Ref.3 | ||||||
| Sequence conflict | 67 | 1 | Q → H in BAF83360. Ref.2 | ||||||
| Sequence conflict | 118 | 1 | C → Y in BAA91460. Ref.2 | ||||||
| Sequence conflict | 339 | 1 | S → C in AAD38517. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Human homolog of GDP-mannose pyrophosphorylase." Matthijs G., Schollen E., Dierickx D. Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryo. |
| [3] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney. |
| [4] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed: 15815621] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA]. Tissue: Lymph. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed: 21269460] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF135422 mRNA. Translation: AAD38517.1. Frameshift. AK000999 mRNA. Translation: BAA91460.1. AK022578 mRNA. Translation: BAG51096.1. AK290671 mRNA. Translation: BAF83360.1. AK222951 mRNA. Translation: BAD96671.1. AC053503 Genomic DNA. Translation: AAY15053.1. CH471063 Genomic DNA. Translation: EAW70755.1. CH471063 Genomic DNA. Translation: EAW70759.1. BC007456 mRNA. Translation: AAH07456.1. |
| IPI | IPI00101782. IPI00657888. |
| RefSeq | NP_037467.2. NM_013335.3. NP_995319.1. NM_205847.2. |
| UniGene | Hs.27059. |
3D structure databases | |
| ProteinModelPortal | Q96IJ6. |
| SMR | Q96IJ6. Positions 3-119, 287-362, 366-400. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96IJ6. 3 interactions. |
| MINT | MINT-3053969. |
| STRING | Q96IJ6. |
Polymorphism databases | |
| DMDM | 74732065. |
Proteomic databases | |
| PRIDE | Q96IJ6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000313597; ENSP00000315925; ENSG00000144591. ENST00000341142; ENSP00000340760; ENSG00000144591. ENST00000358215; ENSP00000350949; ENSG00000144591. ENST00000373908; ENSP00000363016; ENSG00000144591. |
| GeneID | 29926. |
| KEGG | hsa:29926. |
| UCSC | uc002vlr.1. human. uc002vlt.1. human. |
Organism-specific databases | |
| CTD | 29926. |
| GeneCards | GC02P220327. |
| HGNC | HGNC:22923. GMPPA. |
| HPA | HPA035513. |
| neXtProt | NX_Q96IJ6. |
| PharmGKB | PA134925506. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG10047. |
| GeneTree | ENSGT00530000063581. |
| HOVERGEN | HBG059531. |
| OMA | PFAKMDN. |
| OrthoDB | EOG4SXNCG. |
| PhylomeDB | Q96IJ6. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. |
Gene expression databases | |
| ArrayExpress | Q96IJ6. |
| Bgee | Q96IJ6. |
| CleanEx | HS_GMPPA. |
| Genevestigator | Q96IJ6. |
Family and domain databases | |
| InterPro | IPR001451. Hexapep_transf. IPR018357. Hexapep_transf_CS. IPR005835. NTP_transferase. [Graphical view] |
| KO | K00966. |
| Pfam | PF00132. Hexapep. 1 hit. PF00483. NTP_transferase. 1 hit. [Graphical view] |
| PROSITE | PS00101. HEXAPEP_TRANSFERASES. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 52545. |
Entry information
| Entry name | GMPPA_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96IJ6 Secondary accession number(s): A6NJ74 Q9Y5P5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with