Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat and calponin homology domain-containing protein 3

Gene

LRCH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat and calponin homology domain-containing protein 3
Gene namesi
Name:LRCH3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

EuPathDBiHostDB:ENSG00000186001.12
HGNCiHGNC:28637 LRCH3
neXtProtiNX_Q96II8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186001
PharmGKBiPA134923024

Polymorphism and mutation databases

BioMutaiLRCH3
DMDMi116248531

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000025348423 – 777Leucine-rich repeat and calponin homology domain-containing protein 3Add BLAST755

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei324PhosphoserineCombined sources1
Modified residuei415PhosphoserineCombined sources1
Modified residuei419PhosphoserineCombined sources1
Modified residuei611PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96II8
MaxQBiQ96II8
PaxDbiQ96II8
PeptideAtlasiQ96II8
PRIDEiQ96II8

PTM databases

iPTMnetiQ96II8
PhosphoSitePlusiQ96II8

Expressioni

Gene expression databases

BgeeiENSG00000186001
CleanExiHS_LRCH3
ExpressionAtlasiQ96II8 baseline and differential
GenevisibleiQ96II8 HS

Organism-specific databases

HPAiHPA012380
HPA017299

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DOCK8Q8NF50-23EBI-8795942,EBI-10174653

Protein-protein interaction databases

BioGridi124307, 36 interactors
IntActiQ96II8, 29 interactors
STRINGi9606.ENSP00000334375

Structurei

3D structure databases

ProteinModelPortaliQ96II8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati83 – 104LRR 1Add BLAST22
Repeati106 – 128LRR 2Add BLAST23
Repeati129 – 151LRR 3Add BLAST23
Repeati152 – 172LRR 4Add BLAST21
Repeati174 – 195LRR 5Add BLAST22
Repeati197 – 219LRR 6Add BLAST23
Repeati220 – 241LRR 7Add BLAST22
Repeati242 – 263LRR 8Add BLAST22
Repeati268 – 290LRR 9Add BLAST23
Domaini652 – 765Calponin-homology (CH)PROSITE-ProRule annotationAdd BLAST114

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi384 – 389Poly-Glu6

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal

Phylogenomic databases

eggNOGiKOG0532 Eukaryota
COG4886 LUCA
GeneTreeiENSGT00900000140805
HOGENOMiHOG000049055
HOVERGENiHBG052350
InParanoidiQ96II8
OMAiHNQLSHT
OrthoDBiEOG091G05CB
PhylomeDBiQ96II8
TreeFamiTF318428

Family and domain databases

Gene3Di1.10.418.10, 1 hit
3.80.10.10, 1 hit
InterProiView protein in InterPro
IPR001715 CH-domain
IPR036872 CH_dom_sf
IPR001611 Leu-rich_rpt
IPR003591 Leu-rich_rpt_typical-subtyp
IPR032675 LRR_dom_sf
PfamiView protein in Pfam
PF00307 CH, 1 hit
PF13855 LRR_8, 2 hits
SMARTiView protein in SMART
SM00033 CH, 1 hit
SM00369 LRR_TYP, 5 hits
SUPFAMiSSF47576 SSF47576, 1 hit
PROSITEiView protein in PROSITE
PS50021 CH, 1 hit

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96II8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGLVAVA AAAEYSGTVA SGGNLPGVHC GPSSGAGPGF GPGSWSRSLD
60 70 80 90 100
RALEEAAVTG VLSLSGRKLR EFPRGAANHD LTDTTRADLS RNRLSEIPIE
110 120 130 140 150
ACHFVSLENL NLYQNCIRYI PEAILNLQAL TFLNISRNQL STLPVHLCNL
160 170 180 190 200
PLKVLIASNN KLVSLPEEIG HLRHLMELDV SCNEIQTIPS QIGNLEALRD
210 220 230 240 250
LNVRRNHLVH LPEELAELPL IRLDFSCNKI TTIPVCYRNL RHLQTITLDN
260 270 280 290 300
NPLQSPPAQI CIKGKVHIFK YLNIQACKIA PDLPDYDRRP LGFGSCHEEL
310 320 330 340 350
YSSRPYGALD SGFNSVDSGD KRWSGNEPTD EFSDLPLRVA EITKEQRLRR
360 370 380 390 400
ESQYQENRGS LVVTNGGVEH DLDQIDYIDS CTAEEEEAEV RQPKGPDPDS
410 420 430 440 450
LSSQFMAYIE QRRISHEGSP VKPVAIREFQ KTEDMRRYLH QNRVPAEPSS
460 470 480 490 500
LLSLSASHNQ LSHTDLELHQ RREQLVERTR REAQLAALQY EEEKIRTKQI
510 520 530 540 550
QRDAVLDFVK QKASQSPQKQ HPLLDGVDGE CPFPSRRSQH TDDSALCMSL
560 570 580 590 600
SGLNQVGCAA TLPHSSAFTP LKSDDRPNAL LSSPATETVH HSPAYSFPAA
610 620 630 640 650
IQRNQPQRPE SFLFRAGVRA ETNKGHASPL PPSAAPTTDS TDSITGQNSR
660 670 680 690 700
QREEELELID QLRKHIEYRL KVSLPCDLGA ALTDGVVLCH LANHVRPRSV
710 720 730 740 750
PSIHVPSPAV PKLTMAKCRR NVENFLEACR KIGVPQEQLC LPLHILEEKG
760 770
LSQVAVTVQA LLELAPPKQQ QHQLSAV
Length:777
Mass (Da):86,083
Last modified:October 17, 2006 - v2
Checksum:iAB317F58DB98AB4A
GO
Isoform 2 (identifier: Q96II8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     737-777: EQLCLPLHIL...KQQQHQLSAV → DNLCSPSDIL...VLYYWLFPAR

Note: No experimental confirmation available.
Show »
Length:803
Mass (Da):89,116
Checksum:iFB84B21DED9AE758
GO
Isoform 3 (identifier: Q96II8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     711-777: PKLTMAKCRRNVENFLEACRKIGVPQEQLCLPLHILEEKGLSQVAVTVQALLELAPPKQQQHQLSAV → VS

Note: No experimental confirmation available.
Show »
Length:712
Mass (Da):78,802
Checksum:i9666F38A42034D34
GO
Isoform 4 (identifier: Q96II8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-416: Missing.
     549-572: Missing.

Note: No experimental confirmation available.
Show »
Length:725
Mass (Da):80,447
Checksum:i20B6CF6B973E3D3F
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056931522P → L. Corresponds to variant dbSNP:rs36078463Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057212389 – 416Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_057213549 – 572Missing in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_021043711 – 777PKLTM…QLSAV → VS in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_021044737 – 777EQLCL…QLSAV → DNLCSPSDILQLNLSVKRTV ETLLSLGAHSEESSFVCLSL QLLGFVAFYCTVMLTLCVLY YWLFPAR in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303521 mRNA Translation: BAG64549.1
AC055764 Genomic DNA No translation available.
AC135893 Genomic DNA No translation available.
AC144530 Genomic DNA No translation available.
BC007504 mRNA Translation: AAH07504.1
BC010565 mRNA Translation: AAH10565.1
AL137527 mRNA Translation: CAB70791.1
CCDSiCCDS3330.1 [Q96II8-3]
PIRiT46371
RefSeqiNP_116162.1, NM_032773.3 [Q96II8-3]
XP_005269419.1, XM_005269362.2 [Q96II8-2]
XP_006713854.1, XM_006713791.3 [Q96II8-1]
UniGeneiHs.518414
Hs.744956

Genome annotation databases

EnsembliENST00000334859; ENSP00000334375; ENSG00000186001 [Q96II8-3]
ENST00000414675; ENSP00000394965; ENSG00000186001 [Q96II8-4]
ENST00000425562; ENSP00000393579; ENSG00000186001 [Q96II8-1]
ENST00000438796; ENSP00000399751; ENSG00000186001 [Q96II8-2]
GeneIDi84859
KEGGihsa:84859
UCSCiuc003fyj.1 human [Q96II8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLRCH3_HUMAN
AccessioniPrimary (citable) accession number: Q96II8
Secondary accession number(s): B4E0T7, Q96FP9, Q9NT52
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: March 28, 2018
This is version 133 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health