Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat and calponin homology domain-containing protein 3

Gene

LRCH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:G66-33121-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat and calponin homology domain-containing protein 3
Gene namesi
Name:LRCH3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:28637. LRCH3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000186001.
PharmGKBiPA134923024.

Polymorphism and mutation databases

BioMutaiLRCH3.
DMDMi116248531.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000025348423 – 777Leucine-rich repeat and calponin homology domain-containing protein 3Add BLAST755

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei324PhosphoserineCombined sources1
Modified residuei415PhosphoserineCombined sources1
Modified residuei419PhosphoserineCombined sources1
Modified residuei611PhosphoserineCombined sources1
Modified residuei628PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96II8.
MaxQBiQ96II8.
PaxDbiQ96II8.
PeptideAtlasiQ96II8.
PRIDEiQ96II8.

PTM databases

iPTMnetiQ96II8.
PhosphoSitePlusiQ96II8.

Expressioni

Gene expression databases

BgeeiENSG00000186001.
CleanExiHS_LRCH3.
ExpressionAtlasiQ96II8. baseline and differential.
GenevisibleiQ96II8. HS.

Organism-specific databases

HPAiHPA012380.
HPA017299.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DOCK8Q8NF50-23EBI-8795942,EBI-10174653

Protein-protein interaction databases

BioGridi124307. 35 interactors.
IntActiQ96II8. 29 interactors.
STRINGi9606.ENSP00000334375.

Structurei

3D structure databases

ProteinModelPortaliQ96II8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati83 – 104LRR 1Add BLAST22
Repeati106 – 128LRR 2Add BLAST23
Repeati129 – 151LRR 3Add BLAST23
Repeati152 – 172LRR 4Add BLAST21
Repeati174 – 195LRR 5Add BLAST22
Repeati197 – 219LRR 6Add BLAST23
Repeati220 – 241LRR 7Add BLAST22
Repeati242 – 263LRR 8Add BLAST22
Repeati268 – 290LRR 9Add BLAST23
Domaini652 – 765CHPROSITE-ProRule annotationAdd BLAST114

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi384 – 389Poly-Glu6

Sequence similaritiesi

Contains 1 CH (calponin-homology) domain.PROSITE-ProRule annotation
Contains 9 LRR (leucine-rich) repeats.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal

Phylogenomic databases

eggNOGiKOG0532. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129676.
HOGENOMiHOG000049055.
HOVERGENiHBG052350.
InParanoidiQ96II8.
OMAiFQKTEDM.
OrthoDBiEOG091G05CB.
PhylomeDBiQ96II8.
TreeFamiTF318428.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF00307. CH. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00369. LRR_TYP. 5 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF52058. SSF52058. 2 hits.
PROSITEiPS50021. CH. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96II8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGLVAVA AAAEYSGTVA SGGNLPGVHC GPSSGAGPGF GPGSWSRSLD
60 70 80 90 100
RALEEAAVTG VLSLSGRKLR EFPRGAANHD LTDTTRADLS RNRLSEIPIE
110 120 130 140 150
ACHFVSLENL NLYQNCIRYI PEAILNLQAL TFLNISRNQL STLPVHLCNL
160 170 180 190 200
PLKVLIASNN KLVSLPEEIG HLRHLMELDV SCNEIQTIPS QIGNLEALRD
210 220 230 240 250
LNVRRNHLVH LPEELAELPL IRLDFSCNKI TTIPVCYRNL RHLQTITLDN
260 270 280 290 300
NPLQSPPAQI CIKGKVHIFK YLNIQACKIA PDLPDYDRRP LGFGSCHEEL
310 320 330 340 350
YSSRPYGALD SGFNSVDSGD KRWSGNEPTD EFSDLPLRVA EITKEQRLRR
360 370 380 390 400
ESQYQENRGS LVVTNGGVEH DLDQIDYIDS CTAEEEEAEV RQPKGPDPDS
410 420 430 440 450
LSSQFMAYIE QRRISHEGSP VKPVAIREFQ KTEDMRRYLH QNRVPAEPSS
460 470 480 490 500
LLSLSASHNQ LSHTDLELHQ RREQLVERTR REAQLAALQY EEEKIRTKQI
510 520 530 540 550
QRDAVLDFVK QKASQSPQKQ HPLLDGVDGE CPFPSRRSQH TDDSALCMSL
560 570 580 590 600
SGLNQVGCAA TLPHSSAFTP LKSDDRPNAL LSSPATETVH HSPAYSFPAA
610 620 630 640 650
IQRNQPQRPE SFLFRAGVRA ETNKGHASPL PPSAAPTTDS TDSITGQNSR
660 670 680 690 700
QREEELELID QLRKHIEYRL KVSLPCDLGA ALTDGVVLCH LANHVRPRSV
710 720 730 740 750
PSIHVPSPAV PKLTMAKCRR NVENFLEACR KIGVPQEQLC LPLHILEEKG
760 770
LSQVAVTVQA LLELAPPKQQ QHQLSAV
Length:777
Mass (Da):86,083
Last modified:October 17, 2006 - v2
Checksum:iAB317F58DB98AB4A
GO
Isoform 2 (identifier: Q96II8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     737-777: EQLCLPLHIL...KQQQHQLSAV → DNLCSPSDIL...VLYYWLFPAR

Note: No experimental confirmation available.
Show »
Length:803
Mass (Da):89,116
Checksum:iFB84B21DED9AE758
GO
Isoform 3 (identifier: Q96II8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     711-777: PKLTMAKCRRNVENFLEACRKIGVPQEQLCLPLHILEEKGLSQVAVTVQALLELAPPKQQQHQLSAV → VS

Note: No experimental confirmation available.
Show »
Length:712
Mass (Da):78,802
Checksum:i9666F38A42034D34
GO
Isoform 4 (identifier: Q96II8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-416: Missing.
     549-572: Missing.

Note: No experimental confirmation available.
Show »
Length:725
Mass (Da):80,447
Checksum:i20B6CF6B973E3D3F
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_056931522P → L.Corresponds to variant rs36078463dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057212389 – 416Missing in isoform 4. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_057213549 – 572Missing in isoform 4. 1 PublicationAdd BLAST24
Alternative sequenceiVSP_021043711 – 777PKLTM…QLSAV → VS in isoform 3. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_021044737 – 777EQLCL…QLSAV → DNLCSPSDILQLNLSVKRTV ETLLSLGAHSEESSFVCLSL QLLGFVAFYCTVMLTLCVLY YWLFPAR in isoform 2. 1 PublicationAdd BLAST41

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303521 mRNA. Translation: BAG64549.1.
AC055764 Genomic DNA. No translation available.
AC135893 Genomic DNA. No translation available.
AC144530 Genomic DNA. No translation available.
BC007504 mRNA. Translation: AAH07504.1.
BC010565 mRNA. Translation: AAH10565.1.
AL137527 mRNA. Translation: CAB70791.1.
CCDSiCCDS3330.1. [Q96II8-3]
PIRiT46371.
RefSeqiNP_116162.1. NM_032773.3. [Q96II8-3]
XP_005269419.1. XM_005269362.2. [Q96II8-2]
XP_006713854.1. XM_006713791.3. [Q96II8-1]
UniGeneiHs.518414.
Hs.744956.

Genome annotation databases

EnsembliENST00000334859; ENSP00000334375; ENSG00000186001. [Q96II8-3]
ENST00000414675; ENSP00000394965; ENSG00000186001. [Q96II8-4]
ENST00000425562; ENSP00000393579; ENSG00000186001. [Q96II8-1]
ENST00000438796; ENSP00000399751; ENSG00000186001. [Q96II8-2]
GeneIDi84859.
KEGGihsa:84859.
UCSCiuc003fyj.1. human. [Q96II8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303521 mRNA. Translation: BAG64549.1.
AC055764 Genomic DNA. No translation available.
AC135893 Genomic DNA. No translation available.
AC144530 Genomic DNA. No translation available.
BC007504 mRNA. Translation: AAH07504.1.
BC010565 mRNA. Translation: AAH10565.1.
AL137527 mRNA. Translation: CAB70791.1.
CCDSiCCDS3330.1. [Q96II8-3]
PIRiT46371.
RefSeqiNP_116162.1. NM_032773.3. [Q96II8-3]
XP_005269419.1. XM_005269362.2. [Q96II8-2]
XP_006713854.1. XM_006713791.3. [Q96II8-1]
UniGeneiHs.518414.
Hs.744956.

3D structure databases

ProteinModelPortaliQ96II8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124307. 35 interactors.
IntActiQ96II8. 29 interactors.
STRINGi9606.ENSP00000334375.

PTM databases

iPTMnetiQ96II8.
PhosphoSitePlusiQ96II8.

Polymorphism and mutation databases

BioMutaiLRCH3.
DMDMi116248531.

Proteomic databases

EPDiQ96II8.
MaxQBiQ96II8.
PaxDbiQ96II8.
PeptideAtlasiQ96II8.
PRIDEiQ96II8.

Protocols and materials databases

DNASUi84859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334859; ENSP00000334375; ENSG00000186001. [Q96II8-3]
ENST00000414675; ENSP00000394965; ENSG00000186001. [Q96II8-4]
ENST00000425562; ENSP00000393579; ENSG00000186001. [Q96II8-1]
ENST00000438796; ENSP00000399751; ENSG00000186001. [Q96II8-2]
GeneIDi84859.
KEGGihsa:84859.
UCSCiuc003fyj.1. human. [Q96II8-1]

Organism-specific databases

CTDi84859.
GeneCardsiLRCH3.
HGNCiHGNC:28637. LRCH3.
HPAiHPA012380.
HPA017299.
neXtProtiNX_Q96II8.
OpenTargetsiENSG00000186001.
PharmGKBiPA134923024.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0532. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129676.
HOGENOMiHOG000049055.
HOVERGENiHBG052350.
InParanoidiQ96II8.
OMAiFQKTEDM.
OrthoDBiEOG091G05CB.
PhylomeDBiQ96II8.
TreeFamiTF318428.

Enzyme and pathway databases

BioCyciZFISH:G66-33121-MONOMER.

Miscellaneous databases

ChiTaRSiLRCH3. human.
GenomeRNAii84859.
PROiQ96II8.

Gene expression databases

BgeeiENSG00000186001.
CleanExiHS_LRCH3.
ExpressionAtlasiQ96II8. baseline and differential.
GenevisibleiQ96II8. HS.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF00307. CH. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00369. LRR_TYP. 5 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF52058. SSF52058. 2 hits.
PROSITEiPS50021. CH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLRCH3_HUMAN
AccessioniPrimary (citable) accession number: Q96II8
Secondary accession number(s): B4E0T7, Q96FP9, Q9NT52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: November 30, 2016
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.