Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat and calponin homology domain-containing protein 3

Gene

LRCH3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat and calponin homology domain-containing protein 3
Gene namesi
Name:LRCH3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:28637. LRCH3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134923024.

Polymorphism and mutation databases

BioMutaiLRCH3.
DMDMi116248531.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence analysisAdd
BLAST
Chaini23 – 777755Leucine-rich repeat and calponin homology domain-containing protein 3PRO_0000253484Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei324 – 3241PhosphoserineCombined sources
Modified residuei415 – 4151PhosphoserineCombined sources
Modified residuei628 – 6281PhosphoserineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96II8.
MaxQBiQ96II8.
PaxDbiQ96II8.
PRIDEiQ96II8.

PTM databases

iPTMnetiQ96II8.
PhosphoSiteiQ96II8.

Expressioni

Gene expression databases

BgeeiQ96II8.
CleanExiHS_LRCH3.
ExpressionAtlasiQ96II8. baseline and differential.
GenevisibleiQ96II8. HS.

Organism-specific databases

HPAiHPA012380.
HPA017299.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
DOCK8Q8NF50-23EBI-8795942,EBI-10174653

Protein-protein interaction databases

BioGridi124307. 35 interactions.
IntActiQ96II8. 27 interactions.
STRINGi9606.ENSP00000334375.

Structurei

3D structure databases

ProteinModelPortaliQ96II8.
SMRiQ96II8. Positions 49-310.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati83 – 10422LRR 1Add
BLAST
Repeati106 – 12823LRR 2Add
BLAST
Repeati129 – 15123LRR 3Add
BLAST
Repeati152 – 17221LRR 4Add
BLAST
Repeati174 – 19522LRR 5Add
BLAST
Repeati197 – 21923LRR 6Add
BLAST
Repeati220 – 24122LRR 7Add
BLAST
Repeati242 – 26322LRR 8Add
BLAST
Repeati268 – 29023LRR 9Add
BLAST
Domaini652 – 765114CHPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi384 – 3896Poly-Glu

Sequence similaritiesi

Contains 1 CH (calponin-homology) domain.PROSITE-ProRule annotation
Contains 9 LRR (leucine-rich) repeats.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat, Signal

Phylogenomic databases

eggNOGiKOG0532. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129676.
HOGENOMiHOG000049055.
HOVERGENiHBG052350.
InParanoidiQ96II8.
OMAiDMRRYSH.
OrthoDBiEOG7288QT.
PhylomeDBiQ96II8.
TreeFamiTF318428.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF00307. CH. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00369. LRR_TYP. 5 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF52058. SSF52058. 2 hits.
PROSITEiPS50021. CH. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96II8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAAGLVAVA AAAEYSGTVA SGGNLPGVHC GPSSGAGPGF GPGSWSRSLD
60 70 80 90 100
RALEEAAVTG VLSLSGRKLR EFPRGAANHD LTDTTRADLS RNRLSEIPIE
110 120 130 140 150
ACHFVSLENL NLYQNCIRYI PEAILNLQAL TFLNISRNQL STLPVHLCNL
160 170 180 190 200
PLKVLIASNN KLVSLPEEIG HLRHLMELDV SCNEIQTIPS QIGNLEALRD
210 220 230 240 250
LNVRRNHLVH LPEELAELPL IRLDFSCNKI TTIPVCYRNL RHLQTITLDN
260 270 280 290 300
NPLQSPPAQI CIKGKVHIFK YLNIQACKIA PDLPDYDRRP LGFGSCHEEL
310 320 330 340 350
YSSRPYGALD SGFNSVDSGD KRWSGNEPTD EFSDLPLRVA EITKEQRLRR
360 370 380 390 400
ESQYQENRGS LVVTNGGVEH DLDQIDYIDS CTAEEEEAEV RQPKGPDPDS
410 420 430 440 450
LSSQFMAYIE QRRISHEGSP VKPVAIREFQ KTEDMRRYLH QNRVPAEPSS
460 470 480 490 500
LLSLSASHNQ LSHTDLELHQ RREQLVERTR REAQLAALQY EEEKIRTKQI
510 520 530 540 550
QRDAVLDFVK QKASQSPQKQ HPLLDGVDGE CPFPSRRSQH TDDSALCMSL
560 570 580 590 600
SGLNQVGCAA TLPHSSAFTP LKSDDRPNAL LSSPATETVH HSPAYSFPAA
610 620 630 640 650
IQRNQPQRPE SFLFRAGVRA ETNKGHASPL PPSAAPTTDS TDSITGQNSR
660 670 680 690 700
QREEELELID QLRKHIEYRL KVSLPCDLGA ALTDGVVLCH LANHVRPRSV
710 720 730 740 750
PSIHVPSPAV PKLTMAKCRR NVENFLEACR KIGVPQEQLC LPLHILEEKG
760 770
LSQVAVTVQA LLELAPPKQQ QHQLSAV
Length:777
Mass (Da):86,083
Last modified:October 17, 2006 - v2
Checksum:iAB317F58DB98AB4A
GO
Isoform 2 (identifier: Q96II8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     737-777: EQLCLPLHIL...KQQQHQLSAV → DNLCSPSDIL...VLYYWLFPAR

Note: No experimental confirmation available.
Show »
Length:803
Mass (Da):89,116
Checksum:iFB84B21DED9AE758
GO
Isoform 3 (identifier: Q96II8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     711-777: PKLTMAKCRRNVENFLEACRKIGVPQEQLCLPLHILEEKGLSQVAVTVQALLELAPPKQQQHQLSAV → VS

Note: No experimental confirmation available.
Show »
Length:712
Mass (Da):78,802
Checksum:i9666F38A42034D34
GO
Isoform 4 (identifier: Q96II8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     389-416: Missing.
     549-572: Missing.

Note: No experimental confirmation available.
Show »
Length:725
Mass (Da):80,447
Checksum:i20B6CF6B973E3D3F
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti522 – 5221P → L.
Corresponds to variant rs36078463 [ dbSNP | Ensembl ].
VAR_056931

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei389 – 41628Missing in isoform 4. 1 PublicationVSP_057212Add
BLAST
Alternative sequencei549 – 57224Missing in isoform 4. 1 PublicationVSP_057213Add
BLAST
Alternative sequencei711 – 77767PKLTM…QLSAV → VS in isoform 3. 1 PublicationVSP_021043Add
BLAST
Alternative sequencei737 – 77741EQLCL…QLSAV → DNLCSPSDILQLNLSVKRTV ETLLSLGAHSEESSFVCLSL QLLGFVAFYCTVMLTLCVLY YWLFPAR in isoform 2. 1 PublicationVSP_021044Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303521 mRNA. Translation: BAG64549.1.
AC055764 Genomic DNA. No translation available.
AC135893 Genomic DNA. No translation available.
AC144530 Genomic DNA. No translation available.
BC007504 mRNA. Translation: AAH07504.1.
BC010565 mRNA. Translation: AAH10565.1.
AL137527 mRNA. Translation: CAB70791.1.
CCDSiCCDS3330.1. [Q96II8-3]
PIRiT46371.
RefSeqiNP_116162.1. NM_032773.3. [Q96II8-3]
XP_005269419.1. XM_005269362.1. [Q96II8-2]
XP_006713854.1. XM_006713791.2. [Q96II8-1]
UniGeneiHs.518414.
Hs.744956.

Genome annotation databases

EnsembliENST00000334859; ENSP00000334375; ENSG00000186001. [Q96II8-3]
ENST00000414675; ENSP00000394965; ENSG00000186001. [Q96II8-4]
ENST00000425562; ENSP00000393579; ENSG00000186001. [Q96II8-1]
ENST00000438796; ENSP00000399751; ENSG00000186001. [Q96II8-2]
GeneIDi84859.
KEGGihsa:84859.
UCSCiuc003fyj.1. human. [Q96II8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK303521 mRNA. Translation: BAG64549.1.
AC055764 Genomic DNA. No translation available.
AC135893 Genomic DNA. No translation available.
AC144530 Genomic DNA. No translation available.
BC007504 mRNA. Translation: AAH07504.1.
BC010565 mRNA. Translation: AAH10565.1.
AL137527 mRNA. Translation: CAB70791.1.
CCDSiCCDS3330.1. [Q96II8-3]
PIRiT46371.
RefSeqiNP_116162.1. NM_032773.3. [Q96II8-3]
XP_005269419.1. XM_005269362.1. [Q96II8-2]
XP_006713854.1. XM_006713791.2. [Q96II8-1]
UniGeneiHs.518414.
Hs.744956.

3D structure databases

ProteinModelPortaliQ96II8.
SMRiQ96II8. Positions 49-310.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124307. 35 interactions.
IntActiQ96II8. 27 interactions.
STRINGi9606.ENSP00000334375.

PTM databases

iPTMnetiQ96II8.
PhosphoSiteiQ96II8.

Polymorphism and mutation databases

BioMutaiLRCH3.
DMDMi116248531.

Proteomic databases

EPDiQ96II8.
MaxQBiQ96II8.
PaxDbiQ96II8.
PRIDEiQ96II8.

Protocols and materials databases

DNASUi84859.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000334859; ENSP00000334375; ENSG00000186001. [Q96II8-3]
ENST00000414675; ENSP00000394965; ENSG00000186001. [Q96II8-4]
ENST00000425562; ENSP00000393579; ENSG00000186001. [Q96II8-1]
ENST00000438796; ENSP00000399751; ENSG00000186001. [Q96II8-2]
GeneIDi84859.
KEGGihsa:84859.
UCSCiuc003fyj.1. human. [Q96II8-1]

Organism-specific databases

CTDi84859.
GeneCardsiLRCH3.
HGNCiHGNC:28637. LRCH3.
HPAiHPA012380.
HPA017299.
neXtProtiNX_Q96II8.
PharmGKBiPA134923024.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0532. Eukaryota.
COG4886. LUCA.
GeneTreeiENSGT00840000129676.
HOGENOMiHOG000049055.
HOVERGENiHBG052350.
InParanoidiQ96II8.
OMAiDMRRYSH.
OrthoDBiEOG7288QT.
PhylomeDBiQ96II8.
TreeFamiTF318428.

Miscellaneous databases

ChiTaRSiLRCH3. human.
GenomeRNAii84859.
NextBioi35476850.
PROiQ96II8.

Gene expression databases

BgeeiQ96II8.
CleanExiHS_LRCH3.
ExpressionAtlasiQ96II8. baseline and differential.
GenevisibleiQ96II8. HS.

Family and domain databases

Gene3Di1.10.418.10. 1 hit.
3.80.10.10. 2 hits.
InterProiIPR001715. CH-domain.
IPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
IPR003591. Leu-rich_rpt_typical-subtyp.
[Graphical view]
PfamiPF00307. CH. 1 hit.
PF13855. LRR_8. 2 hits.
[Graphical view]
SMARTiSM00033. CH. 1 hit.
SM00369. LRR_TYP. 5 hits.
[Graphical view]
SUPFAMiSSF47576. SSF47576. 1 hit.
SSF52058. SSF52058. 2 hits.
PROSITEiPS50021. CH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Thymus.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 575-777 (ISOFORM 3).
    Tissue: Brain and Muscle.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 624-777 (ISOFORM 2).
    Tissue: Testis.
  5. "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
    Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
    J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-415, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: T-cell.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-324, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-415, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiLRCH3_HUMAN
AccessioniPrimary (citable) accession number: Q96II8
Secondary accession number(s): B4E0T7, Q96FP9, Q9NT52
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: October 17, 2006
Last modified: May 11, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.