Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 625

Gene

ZNF625

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 53C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri69 – 91C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri153 – 175C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri181 – 203C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri209 – 231C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri237 – 259C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri265 – 287C2H2-type 9PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 625
Gene namesi
Name:ZNF625
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000257591.5.
HGNCiHGNC:30571. ZNF625.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000257591.
PharmGKBiPA134911932.

Polymorphism and mutation databases

BioMutaiZNF625.
DMDMi74762662.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002346021 – 306Zinc finger protein 625Add BLAST306

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei209PhosphotyrosineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96I27.
PaxDbiQ96I27.
PeptideAtlasiQ96I27.
PRIDEiQ96I27.

PTM databases

iPTMnetiQ96I27.
PhosphoSitePlusiQ96I27.

Expressioni

Gene expression databases

BgeeiENSG00000257591.
CleanExiHS_ZNF625.
ExpressionAtlasiQ96I27. baseline and differential.
GenevisibleiQ96I27. HS.

Organism-specific databases

HPAiHPA074014.

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124739. 7 interactors.
IntActiQ96I27. 6 interactors.
STRINGi9606.ENSP00000394380.

Structurei

3D structure databases

ProteinModelPortaliQ96I27.
SMRiQ96I27.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri31 – 53C2H2-type 1; degeneratePROSITE-ProRule annotationAdd BLAST23
Zinc fingeri69 – 91C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri97 – 119C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri125 – 147C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri153 – 175C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri181 – 203C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri209 – 231C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri237 – 259C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri265 – 287C2H2-type 9PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119089.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ96I27.
OMAiDGPYKCN.
OrthoDBiEOG091G02KC.
PhylomeDBiQ96I27.
TreeFamiTF338854.

Family and domain databases

InterProiView protein in InterPro
IPR013087. Znf_C2H2_type.
SMARTiView protein in SMART
SM00355. ZnF_C2H2. 8 hits.
SUPFAMiSSF57667. SSF57667. 4 hits.
PROSITEiView protein in PROSITE
PS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96I27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGERLLESKK DHQHGEILTQ VPDDMLKKKT PRVKSCGEVS VGHASLNRHH
60 70 80 90 100
RADTGHKPYE YQEYGQKPYK CTYCKKAFSD LPYFRTHEWA HTGGKPYDCE
110 120 130 140 150
ECGKSFISRS SIRRHRIMHS GDGPYKCNFC GKALMCLSLY LIHKRTHTGE
160 170 180 190 200
KPYECKQCGK AFSHSGSLRI HERTHTGEKP YECSECGKAF HSSTCLHAHK
210 220 230 240 250
ITHTGEKPYE CKQCGKAFVS FNSVRYHERT HTGEKPYECK QCGKAFRSAS
260 270 280 290 300
HLRTHGRTHT GEKPYECKQC GKAFGCASSV KIHERTHTGE KPCSSNTSKG

QGEKIA
Length:306
Mass (Da):34,746
Last modified:December 1, 2001 - v1
Checksum:i49A28E02E8D66464
GO
Isoform 2 (identifier: Q96I27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDSVVFEDVDVNFTQEEWALLDPSQKNLYRDVMQETFRNLASVGKKWKDQKIEDEYKNPRRNLRGLM

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):42,663
Checksum:iB8F6095A25B343AC
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05288241V → M. Corresponds to variant dbSNP:rs7258368Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0463271M → MDSVVFEDVDVNFTQEEWAL LDPSQKNLYRDVMQETFRNL ASVGKKWKDQKIEDEYKNPR RNLRGLM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022415 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84261.1.
CH471106 Genomic DNA. Translation: EAW84263.1.
BC007868 mRNA. Translation: AAH07868.1.
BC101589 mRNA. Translation: AAI01590.1.
BC101591 mRNA. Translation: AAI01592.1.
BC143563 mRNA. Translation: AAI43564.1.
DN991057 mRNA. No translation available.
CCDSiCCDS12269.2. [Q96I27-2]
RefSeqiNP_660276.2. NM_145233.3. [Q96I27-2]
UniGeneiHs.732736.

Genome annotation databases

EnsembliENST00000439556; ENSP00000394380; ENSG00000257591. [Q96I27-2]
GeneIDi90589.
KEGGihsa:90589.
UCSCiuc010dyo.3. human. [Q96I27-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiZN625_HUMAN
AccessioniPrimary (citable) accession number: Q96I27
Secondary accession number(s): A4FU45, I3L0E9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: September 27, 2017
This is version 134 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families