Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 625

Gene

ZNF625

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 5323C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri69 – 9123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri97 – 11923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri125 – 14723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri153 – 17523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri181 – 20323C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri209 – 23123C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri237 – 25923C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri265 – 28723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 625
Gene namesi
Name:ZNF625
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:30571. ZNF625.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134911932.

Polymorphism and mutation databases

BioMutaiZNF625.
DMDMi74762662.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 306306Zinc finger protein 625PRO_0000234602Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei209 – 2091PhosphotyrosineBy similarity

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96I27.
PaxDbiQ96I27.
PRIDEiQ96I27.

PTM databases

iPTMnetiQ96I27.
PhosphoSiteiQ96I27.

Expressioni

Gene expression databases

BgeeiQ96I27.
CleanExiHS_ZNF625.
ExpressionAtlasiQ96I27. baseline and differential.
GenevisibleiQ96I27. HS.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
KRT40Q6A1623EBI-4395587,EBI-10171697
KRTAP10-4P603723EBI-4395587,EBI-10178153
KRTAP10-7P604093EBI-4395587,EBI-10172290
KRTAP10-9P604113EBI-4395587,EBI-10172052

Protein-protein interaction databases

BioGridi124739. 6 interactions.
IntActiQ96I27. 5 interactions.
STRINGi9606.ENSP00000394380.

Structurei

3D structure databases

ProteinModelPortaliQ96I27.
SMRiQ96I27. Positions 29-292.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Contains 9 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri31 – 5323C2H2-type 1; degeneratePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri69 – 9123C2H2-type 2PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri97 – 11923C2H2-type 3PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri125 – 14723C2H2-type 4PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri153 – 17523C2H2-type 5PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri181 – 20323C2H2-type 6PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri209 – 23123C2H2-type 7PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri237 – 25923C2H2-type 8PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri265 – 28723C2H2-type 9PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119089.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ96I27.
OMAiRTHEWAH.
PhylomeDBiQ96I27.
TreeFamiTF338854.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 8 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96I27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGERLLESKK DHQHGEILTQ VPDDMLKKKT PRVKSCGEVS VGHASLNRHH
60 70 80 90 100
RADTGHKPYE YQEYGQKPYK CTYCKKAFSD LPYFRTHEWA HTGGKPYDCE
110 120 130 140 150
ECGKSFISRS SIRRHRIMHS GDGPYKCNFC GKALMCLSLY LIHKRTHTGE
160 170 180 190 200
KPYECKQCGK AFSHSGSLRI HERTHTGEKP YECSECGKAF HSSTCLHAHK
210 220 230 240 250
ITHTGEKPYE CKQCGKAFVS FNSVRYHERT HTGEKPYECK QCGKAFRSAS
260 270 280 290 300
HLRTHGRTHT GEKPYECKQC GKAFGCASSV KIHERTHTGE KPCSSNTSKG

QGEKIA
Length:306
Mass (Da):34,746
Last modified:December 1, 2001 - v1
Checksum:i49A28E02E8D66464
GO
Isoform 2 (identifier: Q96I27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDSVVFEDVDVNFTQEEWALLDPSQKNLYRDVMQETFRNLASVGKKWKDQKIEDEYKNPRRNLRGLM

Note: No experimental confirmation available.
Show »
Length:372
Mass (Da):42,663
Checksum:iB8F6095A25B343AC
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti41 – 411V → M.
Corresponds to variant rs7258368 [ dbSNP | Ensembl ].
VAR_052882

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MDSVVFEDVDVNFTQEEWAL LDPSQKNLYRDVMQETFRNL ASVGKKWKDQKIEDEYKNPR RNLRGLM in isoform 2. 1 PublicationVSP_046327

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022415 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84261.1.
CH471106 Genomic DNA. Translation: EAW84263.1.
BC007868 mRNA. Translation: AAH07868.1.
BC101589 mRNA. Translation: AAI01590.1.
BC101591 mRNA. Translation: AAI01592.1.
BC143563 mRNA. Translation: AAI43564.1.
DN991057 mRNA. No translation available.
CCDSiCCDS12269.2. [Q96I27-2]
RefSeqiNP_660276.2. NM_145233.3. [Q96I27-2]
UniGeneiHs.732736.

Genome annotation databases

EnsembliENST00000439556; ENSP00000394380; ENSG00000257591. [Q96I27-2]
GeneIDi90589.
KEGGihsa:90589.
UCSCiuc010dyo.3. human. [Q96I27-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC022415 Genomic DNA. No translation available.
CH471106 Genomic DNA. Translation: EAW84261.1.
CH471106 Genomic DNA. Translation: EAW84263.1.
BC007868 mRNA. Translation: AAH07868.1.
BC101589 mRNA. Translation: AAI01590.1.
BC101591 mRNA. Translation: AAI01592.1.
BC143563 mRNA. Translation: AAI43564.1.
DN991057 mRNA. No translation available.
CCDSiCCDS12269.2. [Q96I27-2]
RefSeqiNP_660276.2. NM_145233.3. [Q96I27-2]
UniGeneiHs.732736.

3D structure databases

ProteinModelPortaliQ96I27.
SMRiQ96I27. Positions 29-292.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124739. 6 interactions.
IntActiQ96I27. 5 interactions.
STRINGi9606.ENSP00000394380.

PTM databases

iPTMnetiQ96I27.
PhosphoSiteiQ96I27.

Polymorphism and mutation databases

BioMutaiZNF625.
DMDMi74762662.

Proteomic databases

MaxQBiQ96I27.
PaxDbiQ96I27.
PRIDEiQ96I27.

Protocols and materials databases

DNASUi90589.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000439556; ENSP00000394380; ENSG00000257591. [Q96I27-2]
GeneIDi90589.
KEGGihsa:90589.
UCSCiuc010dyo.3. human. [Q96I27-1]

Organism-specific databases

CTDi90589.
GeneCardsiZNF625.
HGNCiHGNC:30571. ZNF625.
neXtProtiNX_Q96I27.
PharmGKBiPA134911932.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00760000119089.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ96I27.
OMAiRTHEWAH.
PhylomeDBiQ96I27.
TreeFamiTF338854.

Enzyme and pathway databases

ReactomeiR-HSA-212436. Generic Transcription Pathway.

Miscellaneous databases

GenomeRNAii90589.
PROiQ96I27.

Gene expression databases

BgeeiQ96I27.
CleanExiHS_ZNF625.
ExpressionAtlasiQ96I27. baseline and differential.
GenevisibleiQ96I27. HS.

Family and domain databases

Gene3Di3.30.160.60. 8 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 2 hits.
PF13912. zf-C2H2_6. 2 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 8 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 8 hits.
PS50157. ZINC_FINGER_C2H2_2. 8 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and biology of human chromosome 19."
    Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
    , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
    Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta and Uterus.
  4. "High-throughput cloning of full-length human cDNAs directly from cDNA libraries optimized for large and rare transcripts."
    Birkett C., Cho J., Gau Y., Hamer R., Kelly S., Kovacs K., Liu L., Liu X., Porter J., Sachs A., Shu Y., Sun Z., Wong J., Wu M., Zhang X., Jay G., He W.
    Submitted (MAY-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-215 (ISOFORM 2).

Entry informationi

Entry nameiZN625_HUMAN
AccessioniPrimary (citable) accession number: Q96I27
Secondary accession number(s): A4FU45, I3L0E9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: June 8, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.