Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Far upstream element-binding protein 3

Gene

FUBP3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May interact with single-stranded DNA from the far-upstream element (FUSE). May activate gene expression.

GO - Molecular functioni

GO - Biological processi

  • positive regulation of gene expression Source: UniProtKB
  • positive regulation of transcription, DNA-templated Source: UniProtKB
  • positive regulation of transcription by RNA polymerase II Source: NTNU_SB
  • transcription, DNA-templated Source: UniProtKB

Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation

Names & Taxonomyi

Protein namesi
Recommended name:
Far upstream element-binding protein 3
Short name:
FUSE-binding protein 3
Gene namesi
Name:FUBP3
Synonyms:FBP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

EuPathDBiHostDB:ENSG00000107164.15
HGNCiHGNC:4005 FUBP3
MIMi603536 gene
neXtProtiNX_Q96I24

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi8939
OpenTargetsiENSG00000107164
PharmGKBiPA28421

Polymorphism and mutation databases

BioMutaiFUBP3
DMDMi37078499

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Initiator methionineiRemovedCombined sources1 Publication
ChainiPRO_00000501402 – 572Far upstream element-binding protein 3Add BLAST571

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei2N-acetylalanineCombined sources1 Publication1
Cross-linki15Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Cross-linki57Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei76PhosphothreonineCombined sources1
Modified residuei296PhosphoserineCombined sources1
Modified residuei539PhosphoserineCombined sources1
Modified residuei569PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96I24
MaxQBiQ96I24
PaxDbiQ96I24
PeptideAtlasiQ96I24
PRIDEiQ96I24

2D gel databases

REPRODUCTION-2DPAGEIPI00377261

PTM databases

iPTMnetiQ96I24
PhosphoSitePlusiQ96I24
SwissPalmiQ96I24

Expressioni

Tissue specificityi

Detected in a number of cell lines.

Gene expression databases

BgeeiENSG00000107164
CleanExiHS_FUBP3
ExpressionAtlasiQ96I24 baseline and differential
GenevisibleiQ96I24 HS

Organism-specific databases

HPAiHPA047658
HPA058392

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
QKIQ96PU84EBI-954200,EBI-945792

Protein-protein interaction databases

BioGridi114451, 65 interactors
DIPiDIP-50124N
IntActiQ96I24, 34 interactors
MINTiQ96I24
STRINGi9606.ENSP00000318177

Structurei

3D structure databases

ProteinModelPortaliQ96I24
SMRiQ96I24
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini77 – 141KH 1PROSITE-ProRule annotationAdd BLAST65
Domaini162 – 228KH 2PROSITE-ProRule annotationAdd BLAST67
Domaini253 – 317KH 3PROSITE-ProRule annotationAdd BLAST65
Domaini354 – 421KH 4PROSITE-ProRule annotationAdd BLAST68

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1676 Eukaryota
ENOG410XZYE LUCA
GeneTreeiENSGT00730000110664
HOGENOMiHOG000231552
HOVERGENiHBG000625
InParanoidiQ96I24
KOiK13210
OMAiQHAAHVI
OrthoDBiEOG091G073X
PhylomeDBiQ96I24
TreeFamiTF313654

Family and domain databases

Gene3Di3.30.1370.10, 4 hits
InterProiView protein in InterPro
IPR004087 KH_dom
IPR004088 KH_dom_type_1
IPR036612 KH_dom_type_1_sf
PfamiView protein in Pfam
PF00013 KH_1, 4 hits
SMARTiView protein in SMART
SM00322 KH, 4 hits
SUPFAMiSSF54791 SSF54791, 4 hits
PROSITEiView protein in PROSITE
PS50084 KH_TYPE_1, 4 hits

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96I24-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAELVQGQSA PVGMKAEGFV DALHRVRQIA AKIDSIPHLN NSTPLVDPSV
60 70 80 90 100
YGYGVQKRPL DDGVGNQLGA LVHQRTVITE EFKVPDKMVG FIIGRGGEQI
110 120 130 140 150
SRIQAESGCK IQIASESSGI PERPCVLTGT PESIEQAKRL LGQIVDRCRN
160 170 180 190 200
GPGFHNDIDS NSTIQEILIP ASKVGLVIGR GGETIKQLQE RTGVKMVMIQ
210 220 230 240 250
DGPLPTGADK PLRITGDAFK VQQAREMVLE IIREKDQADF RGVRGDFNSR
260 270 280 290 300
MGGGSIEVSV PRFAVGIVIG RNGEMIKKIQ NDAGVRIQFK PDDGISPERA
310 320 330 340 350
AQVMGPPDRC QHAAHIISEL ILTAQERDGF GGLAAARGRG RGRGDWSVGA
360 370 380 390 400
PGGVQEITYT VPADKCGLVI GKGGENIKSI NQQSGAHVEL QRNPPPNSDP
410 420 430 440 450
NLRRFTIRGV PQQIEVARQL IDEKVGGTNL GAPGAFGQSP FSQPPAPPHQ
460 470 480 490 500
NTFPPRSSGC FPNMAAKVNG NPHSTPVSGP PAFLTQGWGS TYQAWQQPTQ
510 520 530 540 550
QVPSQQSQPQ SSQPNYSKAW EDYYKKQSHA ASAAPQASSP PDYTMAWAEY
560 570
YRQQVAFYGQ TLGQAQAHSQ EQ
Length:572
Mass (Da):61,640
Last modified:September 26, 2003 - v2
Checksum:iF1BE223542BC197D
GO
Isoform 2 (identifier: Q96I24-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-64: MAELVQGQSAPVGMKAEGFVDALHRVRQIAAKIDSIPHLNNSTPLVDPSVYGYGVQKRPLDDGV → MPPI
     298-548: Missing.

Note: No experimental confirmation available.
Show »
Length:261
Mass (Da):28,492
Checksum:i6D70D9731D957E6D
GO

Sequence cautioni

The sequence AAC50893 differs from that shown. Reason: Frameshift at position 18.Curated
The sequence AAH01325 differs from that shown. Reason: Frameshift at position 527.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti72V → D in AAC50893 (PubMed:8940189).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0083231 – 64MAELV…LDDGV → MPPI in isoform 2. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_008324298 – 548Missing in isoform 2. 1 PublicationAdd BLAST251

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
U69127 mRNA Translation: AAC50893.1 Frameshift.
AK295155 mRNA Translation: BAG58170.1
AL353695 Genomic DNA No translation available.
AL359092 Genomic DNA No translation available.
CH471090 Genomic DNA Translation: EAW87937.1
BC001325 mRNA Translation: AAH01325.1 Frameshift.
BC007874 mRNA Translation: AAH07874.1
BC137338 mRNA Translation: AAI37339.1
BC137340 mRNA Translation: AAI37341.1
CCDSiCCDS43893.1 [Q96I24-1]
RefSeqiNP_003925.1, NM_003934.1 [Q96I24-1]
UniGeneiHs.673029
Hs.740088
Hs.98751

Genome annotation databases

EnsembliENST00000319725; ENSP00000318177; ENSG00000107164 [Q96I24-1]
GeneIDi8939
KEGGihsa:8939
UCSCiuc004bzr.2 human [Q96I24-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiFUBP3_HUMAN
AccessioniPrimary (citable) accession number: Q96I24
Secondary accession number(s): A3KFK8
, A3KFL0, Q92946, Q9BVB6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 26, 2003
Last sequence update: September 26, 2003
Last modified: May 23, 2018
This is version 161 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health