Q96HS1 (PGAM5_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Serine/threonine-protein phosphatase PGAM5, mitochondrial EC=3.1.3.16 Alternative name(s): Bcl-XL-binding protein v68 Phosphoglycerate mutase family member 5 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 289 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Displays phosphatase activity for serine/threonine residues, and, dephosphorylates and activates MAP3K5 kinase. Has apparently no phosphoglycerate mutase activity. May be regulator of mitochondrial dynamics. Substrate for a KEAP1-dependent ubiquitin ligase complex. Contributes to the repression of NFE2L2-dependent gene expression. Acts as a central mediator for programmed necrosis induced by TNF, by reactive oxygen species and by calcium ionophore. Ref.5 Ref.6 Ref.10 |
| Catalytic activity | A phosphoprotein + H2O = a protein + phosphate. |
| Subunit structure | Dimer. Forms a ternary complex with NFE2L2 and KEAP1. Interacts with BCL2L1 and MAP3K5. Upon TNF-induced necrosis, forms in complex with RIPK1, RIPK3 and MLKL; the formation of this complex leads to PGAM5 phosphorylation. Isoform 2, but not isoform 1, interacts with DNM1L; this interaction leads to DNM1L dephosphorylation and activation and eventually to mitochondria fragmentation. Ref.1 Ref.5 Ref.6 Ref.10 |
| Subcellular location | Mitochondrion outer membrane; Single-pass membrane protein. Note: Isoform 2 overexpression results in the formation of disconnected punctuate mitochondria distributed throughout the cytoplasm. Isoform 1 overexpression results in the clustering of mitochondria around the nucleus. Ref.5 |
| Domain | The N-terminal 35 amino acids, including the potential transmembrane alpha-helix, function as a non-cleaved mitochondrial targeting sequence that targets the protein to the cytosolic side of the outer mitochondrial membrane (Ref.5). |
| Post-translational modification | Both isoform 1 and isoform 2 are phosphorylated by the RIPK1/RIPK3 complex under necrotic conditions. This phosphorylation increases PGAM5 phosphatase activity. |
| Sequence similarities | Belongs to the phosphoglycerate mutase family. BPG-dependent PGAM subfamily. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Necrosis |
| Cellular component | Membrane Mitochondrion Mitochondrion outer membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| Molecular function | Hydrolase |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrial outer membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | phosphoprotein phosphatase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96HS1-1) Also known as: PGAM5-L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96HS1-2) Also known as: PGAM5-S; The sequence of this isoform differs from the canonical sequence as follows: 240-289: RALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS → SIPPLLSAGDFVLLGS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 289 | 289 | Serine/threonine-protein phosphatase PGAM5, mitochondrial | PRO_0000288782 | |||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||
| Transmembrane | 7 – 29 | 23 | Helical; Potential | ||||||||||||||||||||||||||||||||
| Region | 77 – 82 | 6 | Interaction with KEAP1 | ||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||
| Modified residue | 80 | 1 | Phosphoserine Ref.9 | ||||||||||||||||||||||||||||||||
| Modified residue | 116 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||
| Modified residue | 144 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||
| Modified residue | 191 | 1 | N6-acetyllysine Ref.7 | ||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||
| Alternative sequence | 240 – 289 | 50 | RALQF…KITRS → SIPPLLSAGDFVLLGS in isoform 2. | VSP_025761 | |||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 79 | 1 | E → A: Loss of interaction with KEAP1; when associated with A-80. Ref.1 | ||||||||||||||||||||||||||||||||
| Mutagenesis | 80 | 1 | S → A: Loss of interaction with KEAP1; when associated with A-79. Ref.1 | ||||||||||||||||||||||||||||||||
| Mutagenesis | 105 | 1 | H → A: Loss of phosphatase activity. Ref.6 | ||||||||||||||||||||||||||||||||
| Sequence conflict | 124 | 1 | G → C in AAK60627. Ref.3 | ||||||||||||||||||||||||||||||||
| Isoform 2: | |||||||||||||||||||||||||||||||||||
| Sequence conflict | 252 | 1 | L → V in AAH08196. Ref.2 | ||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||
| Beta strand | 98 – 104 | 7 | |||||||||||||||||||||||||||||||||
| Helix | 115 – 117 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 122 – 136 | 15 | |||||||||||||||||||||||||||||||||
| Beta strand | 143 – 150 | 8 | |||||||||||||||||||||||||||||||||
| Helix | 151 – 162 | 12 | |||||||||||||||||||||||||||||||||
| Beta strand | 169 – 172 | 4 | |||||||||||||||||||||||||||||||||
| Helix | 173 – 175 | 3 | |||||||||||||||||||||||||||||||||
| Helix | 197 – 211 | 15 | |||||||||||||||||||||||||||||||||
| Beta strand | 223 – 229 | 7 | |||||||||||||||||||||||||||||||||
| Helix | 231 – 241 | 11 | |||||||||||||||||||||||||||||||||
| Helix | 246 – 251 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 259 – 264 | 6 | |||||||||||||||||||||||||||||||||
| Beta strand | 270 – 277 | 8 | |||||||||||||||||||||||||||||||||
| Helix | 283 – 285 | 3 | |||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PGAM5, a Bcl-XL-interacting protein, is a novel substrate for the redox-regulated Keap1-dependent ubiquitin ligase complex." Lo S.-C., Hannink M. J. Biol. Chem. 281:37893-37903(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA], IDENTIFICATION BY MASS SPECTROMETRY, ALTERNATIVE SPLICING, SUBUNIT, INTERACTION WITH BCL2L1 AND KEAP1, MUTAGENESIS OF GLU-79 AND SER-80. |
| [2] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Cervix. |
| [4] | "In vitro selection and characterization of Bcl-X(L)-binding proteins from a mix of tissue-specific mRNA display libraries." Hammond P.W., Alpin J., Rise C.E., Wright M., Kreider B.L. J. Biol. Chem. 276:20898-20906(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 124-157. Tissue: Kidney. |
| [5] | "PGAM5 tethers a ternary complex containing Keap1 and Nrf2 to mitochondria." Lo S.-C., Hannink M. Exp. Cell Res. 314:1789-1803(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBUNIT, INTERACTION WITH NFE2L2 AND KEAP1, FUNCTION, SUBCELLULAR LOCATION. |
| [6] | "Mitochondrial phosphoglycerate mutase 5 uses alternate catalytic activity as a protein serine/threonine phosphatase to activate ASK1." Takeda K., Komuro Y., Hayakawa T., Oguchi H., Ishida Y., Murakami S., Noguchi T., Kinoshita H., Sekine Y., Iemura S., Natsume T., Ichijo H. Proc. Natl. Acad. Sci. U.S.A. 106:12301-12305(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAP3K5, MUTAGENESIS OF HIS-105. |
| [7] | "Lysine acetylation targets protein complexes and co-regulates major cellular functions." Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M. Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-116; LYS-144 AND LYS-191, MASS SPECTROMETRY. |
| [8] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [9] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-80, MASS SPECTROMETRY. |
| [10] | "The mitochondrial phosphatase PGAM5 functions at the convergence point of multiple necrotic death pathways." Wang Z., Jiang H., Chen S., Du F., Wang X. Cell 148:228-243(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN COMPLEX WITH RIPK1; RIPK3 AND MLKL, INTERACTION WITH DNM1L. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | EU249757 mRNA. Translation: ABX39494.1. AC135586 Genomic DNA. No translation available. BC008196 mRNA. Translation: AAH08196.1. AF357523 mRNA. Translation: AAK60627.1. | ||||||||||||||||||
| IPI | IPI00063242. IPI00788907. | ||||||||||||||||||
| RefSeq | NP_001164014.1. NM_001170543.1. NP_612642.2. NM_138575.3. | ||||||||||||||||||
| UniGene | Hs.102558. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q96HS1. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q96HS1. 22 interactions. | ||||||||||||||||||
| MINT | MINT-1385191. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q96HS1. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 150417955. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q96HS1. | ||||||||||||||||||
| PRIDE | Q96HS1. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000317555; ENSP00000321503; ENSG00000247077. ENST00000498926; ENSP00000438465; ENSG00000247077. | ||||||||||||||||||
| GeneID | 192111. | ||||||||||||||||||
| KEGG | hsa:192111. | ||||||||||||||||||
| UCSC | uc001uku.3. human. uc009zyv.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 192111. | ||||||||||||||||||
| GeneCards | GC12P133287. | ||||||||||||||||||
| H-InvDB | HIX0017319. | ||||||||||||||||||
| HGNC | HGNC:28763. PGAM5. | ||||||||||||||||||
| HPA | HPA036978. HPA036979. | ||||||||||||||||||
| MIM | 614939. gene. | ||||||||||||||||||
| neXtProt | NX_Q96HS1. | ||||||||||||||||||
| PharmGKB | PA143485574. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG71348. | ||||||||||||||||||
| HOGENOM | HOG000261217. | ||||||||||||||||||
| HOVERGEN | HBG105576. | ||||||||||||||||||
| InParanoid | Q96HS1. | ||||||||||||||||||
| KO | K15637. | ||||||||||||||||||
| OMA | WLRMSLN. | ||||||||||||||||||
| OrthoDB | EOG4T4CW2. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q96HS1. | ||||||||||||||||||
| Bgee | Q96HS1. | ||||||||||||||||||
| CleanEx | HS_PGAM5. | ||||||||||||||||||
| Genevestigator | Q96HS1. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR013078. His_Pase_superF_clade-1. [Graphical view] | ||||||||||||||||||
| Pfam | PF00300. His_Phos_1. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00855. PGAM. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS00175. PG_MUTASE. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q96HS1. | ||||||||||||||||||
| GenomeRNAi | 192111. | ||||||||||||||||||
| NextBio | 89319. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PGAM5_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96HS1 Secondary accession number(s): A9LN06, C9IZY7, Q96JB0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
