Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CDKN2AIP N-terminal-like protein

Gene

CDKN2AIPNL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
CDKN2AIP N-terminal-like protein
Alternative name(s):
CDKN2A-interacting protein N-terminal-like protein
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:30545. CDKN2AIPNL.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162382150.

Polymorphism and mutation databases

BioMutaiCDKN2AIPNL.
DMDMi74731962.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 116116CDKN2AIP N-terminal-like proteinPRO_0000325926Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ96HQ2.
MaxQBiQ96HQ2.
PaxDbiQ96HQ2.
PeptideAtlasiQ96HQ2.
PRIDEiQ96HQ2.
TopDownProteomicsiQ96HQ2-1. [Q96HQ2-1]

PTM databases

PhosphoSiteiQ96HQ2.

Expressioni

Gene expression databases

BgeeiENSG00000237190.
CleanExiHS_CDKN2AIPNL.
GenevisibleiQ96HQ2. HS.

Organism-specific databases

HPAiHPA043966.

Interactioni

Protein-protein interaction databases

BioGridi124820. 9 interactions.
IntActiQ96HQ2. 10 interactions.
STRINGi9606.ENSP00000394183.

Structurei

3D structure databases

ProteinModelPortaliQ96HQ2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CARF family.Curated

Phylogenomic databases

eggNOGiENOG410IYNI. Eukaryota.
ENOG4111WEJ. LUCA.
GeneTreeiENSGT00530000063234.
HOGENOMiHOG000049179.
HOVERGENiHBG057813.
InParanoidiQ96HQ2.
OMAiSESEKHW.
OrthoDBiEOG091G19SH.
PhylomeDBiQ96HQ2.
TreeFamiTF333807.

Family and domain databases

InterProiIPR021859. XTBD.
[Graphical view]
PfamiPF11952. XTBD. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HQ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVGGEAAAAV EELVSGVRQA ADFAEQFRSY SESEKQWKAR MEFILRHLPD
60 70 80 90 100
YRDPPDGSGR LDQLLSLSMV WANHLFLGCS YNKDLLDKVM EMADGIEVED
110
LPQFTTRSEL MKKHQS
Length:116
Mass (Da):13,196
Last modified:December 1, 2001 - v1
Checksum:i26166C4274FE679C
GO
Isoform 2 (identifier: Q96HQ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     81-116: YNKDLLDKVMEMADGIEVEDLPQFTTRSELMKKHQS → PRGPK

Note: No experimental confirmation available.
Show »
Length:85
Mass (Da):9,509
Checksum:i6CCE2CF58A38A3F7
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei81 – 11636YNKDL…KKHQS → PRGPK in isoform 2. 1 PublicationVSP_032486Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471062 Genomic DNA. Translation: EAW62260.1.
CH471062 Genomic DNA. Translation: EAW62261.1.
BC008293 mRNA. Translation: AAH08293.1.
BC018086 mRNA. Translation: AAH18086.1.
CCDSiCCDS4175.1. [Q96HQ2-1]
RefSeqiNP_542387.1. NM_080656.2. [Q96HQ2-1]
UniGeneiHs.156506.

Genome annotation databases

EnsembliENST00000395009; ENSP00000378456; ENSG00000237190. [Q96HQ2-2]
ENST00000458198; ENSP00000394183; ENSG00000237190. [Q96HQ2-1]
GeneIDi91368.
KEGGihsa:91368.
UCSCiuc011cxs.3. human. [Q96HQ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CH471062 Genomic DNA. Translation: EAW62260.1.
CH471062 Genomic DNA. Translation: EAW62261.1.
BC008293 mRNA. Translation: AAH08293.1.
BC018086 mRNA. Translation: AAH18086.1.
CCDSiCCDS4175.1. [Q96HQ2-1]
RefSeqiNP_542387.1. NM_080656.2. [Q96HQ2-1]
UniGeneiHs.156506.

3D structure databases

ProteinModelPortaliQ96HQ2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124820. 9 interactions.
IntActiQ96HQ2. 10 interactions.
STRINGi9606.ENSP00000394183.

PTM databases

PhosphoSiteiQ96HQ2.

Polymorphism and mutation databases

BioMutaiCDKN2AIPNL.
DMDMi74731962.

Proteomic databases

EPDiQ96HQ2.
MaxQBiQ96HQ2.
PaxDbiQ96HQ2.
PeptideAtlasiQ96HQ2.
PRIDEiQ96HQ2.
TopDownProteomicsiQ96HQ2-1. [Q96HQ2-1]

Protocols and materials databases

DNASUi91368.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000395009; ENSP00000378456; ENSG00000237190. [Q96HQ2-2]
ENST00000458198; ENSP00000394183; ENSG00000237190. [Q96HQ2-1]
GeneIDi91368.
KEGGihsa:91368.
UCSCiuc011cxs.3. human. [Q96HQ2-1]

Organism-specific databases

CTDi91368.
GeneCardsiCDKN2AIPNL.
H-InvDBHIX0019668.
HGNCiHGNC:30545. CDKN2AIPNL.
HPAiHPA043966.
neXtProtiNX_Q96HQ2.
PharmGKBiPA162382150.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IYNI. Eukaryota.
ENOG4111WEJ. LUCA.
GeneTreeiENSGT00530000063234.
HOGENOMiHOG000049179.
HOVERGENiHBG057813.
InParanoidiQ96HQ2.
OMAiSESEKHW.
OrthoDBiEOG091G19SH.
PhylomeDBiQ96HQ2.
TreeFamiTF333807.

Miscellaneous databases

GenomeRNAii91368.
PROiQ96HQ2.

Gene expression databases

BgeeiENSG00000237190.
CleanExiHS_CDKN2AIPNL.
GenevisibleiQ96HQ2. HS.

Family and domain databases

InterProiIPR021859. XTBD.
[Graphical view]
PfamiPF11952. XTBD. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiC2AIL_HUMAN
AccessioniPrimary (citable) accession number: Q96HQ2
Secondary accession number(s): Q8WVE3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.