Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GRAM domain-containing protein 3

Gene

GRAMD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
GRAM domain-containing protein 3
Alternative name(s):
HCV NS3-transactivated protein 2
Gene namesi
Name:GRAMD3
Synonyms:NS3TP2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:24911. GRAMD3.

Subcellular locationi

GO - Cellular componenti

  • cytoplasmic microtubule Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671711.

Polymorphism and mutation databases

BioMutaiGRAMD3.
DMDMi74731934.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 432432GRAM domain-containing protein 3PRO_0000087577Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources
Modified residuei225 – 2251PhosphoserineBy similarity
Modified residuei242 – 2421PhosphoserineBy similarity
Modified residuei252 – 2521PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96HH9.
MaxQBiQ96HH9.
PaxDbiQ96HH9.
PRIDEiQ96HH9.

PTM databases

iPTMnetiQ96HH9.
PhosphoSiteiQ96HH9.

Expressioni

Gene expression databases

BgeeiQ96HH9.
CleanExiHS_GRAMD3.
ExpressionAtlasiQ96HH9. baseline and differential.
GenevisibleiQ96HH9. HS.

Organism-specific databases

HPAiHPA009678.
HPA010095.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ABOB0B1U23EBI-2832937,EBI-10175342
FRMD8Q9BZ673EBI-2832937,EBI-5773072
GIMAP5Q96F153EBI-2832937,EBI-6166686
MORF4L2Q150143EBI-2832937,EBI-399257
NAPRTQ6XQN63EBI-2832937,EBI-10254872
PAEPP094663EBI-2832937,EBI-465167

Protein-protein interaction databases

BioGridi122433. 23 interactions.
IntActiQ96HH9. 7 interactions.
STRINGi9606.ENSP00000426120.

Structurei

3D structure databases

ProteinModelPortaliQ96HH9.
SMRiQ96HH9. Positions 109-215.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini110 – 17768GRAMAdd
BLAST

Sequence similaritiesi

Contains 1 GRAM domain.Curated

Phylogenomic databases

eggNOGiENOG410IRAJ. Eukaryota.
ENOG4111H65. LUCA.
GeneTreeiENSGT00580000081380.
HOGENOMiHOG000082410.
HOVERGENiHBG055715.
InParanoidiQ96HH9.
OMAiHEERDSH.
OrthoDBiEOG77Q4W0.
PhylomeDBiQ96HH9.
TreeFamiTF332065.

Family and domain databases

InterProiIPR004182. GRAM.
[Graphical view]
PfamiPF02893. GRAM. 1 hit.
[Graphical view]
SMARTiSM00568. GRAM. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HH9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTELQQDVED TKPAKVLGKR ESKLGSAHSE AENGVEEKKK ACRSPTAQSP
60 70 80 90 100
TPSVEADSPD QKKIISLWSK SSFDGASLAS DKNDCKTESK NDPKTERKKS
110 120 130 140 150
SSSSQYKANM HFHKLFLSVP TEEPLKQSFT CALQKEILYQ GKLFVSENWI
160 170 180 190 200
CFHSKVFGKD TKISIPAFSV TLIKKTKTAL LVPNALIIAT VTDRYIFVSL
210 220 230 240 250
LSRDSTYKLL KSVCGHLENT SVGNSPNPSS AENSFRADRP SSLPLDFNDE
260 270 280 290 300
FSDLDGVVQQ RRQDMEGYSS SGSQTPESEN SRDFHATESQ TVLNVSKGEA
310 320 330 340 350
KPTRADAHVN RVPEGKAKSL PVQGLSETVG ILHKVKSQKC PMLHHILIFY
360 370 380 390 400
AIVVCALIIS TFYMRYRINT LEEQLGLLTS IVDTHNTEQA APSGLRSQVQ
410 420 430
FNVEVLCQEL TANIVKLEKI QNNLQKLLEN GD
Length:432
Mass (Da):47,869
Last modified:December 1, 2001 - v1
Checksum:i65F5CE61C13D19C4
GO
Isoform 2 (identifier: Q96HH9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-68: MTELQQDVED...PDQKKIISLW → MWKTQSLRKC...PNLCFIQDQE

Note: No experimental confirmation available.
Show »
Length:440
Mass (Da):49,585
Checksum:i41DE0127B5C3E28F
GO
Isoform 3 (identifier: Q96HH9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MTRRQQVLQAKRSIQQTFQAQLMPWKSMFHGREVKPVGPDLEL

Note: No experimental confirmation available.
Show »
Length:447
Mass (Da):49,869
Checksum:i79F9C0CC55E9612A
GO
Isoform 4 (identifier: Q96HH9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-28: MTELQQDVEDTKPAKVLGKRESKLGSAH → MSKVKRFPFFFS

Note: No experimental confirmation available.
Show »
Length:416
Mass (Da):46,294
Checksum:iF44DFAFD659007B0
GO
Isoform 5 (identifier: Q96HH9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-104: Missing.
     105-105: Q → M

Show »
Length:328
Mass (Da):36,649
Checksum:i9B719A910D8AE809
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti260 – 2601Q → R in AAM77213 (Ref. 1) Curated
Sequence conflicti260 – 2601Q → R in BAB15045 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 104104Missing in isoform 5. 1 PublicationVSP_044298Add
BLAST
Alternative sequencei1 – 6868MTELQ…IISLW → MWKTQSLRKCSGRGRANLAQ PTQRLRMVWRRKRKPAGRQQ PNPLPHLWRRTPQTRRKSLA YAHIFSPNLCFIQDQE in isoform 2. 1 PublicationVSP_042883Add
BLAST
Alternative sequencei1 – 2828MTELQ…LGSAH → MTRRQQVLQAKRSIQQTFQA QLMPWKSMFHGREVKPVGPD LEL in isoform 3. 1 PublicationVSP_042884Add
BLAST
Alternative sequencei1 – 2828MTELQ…LGSAH → MSKVKRFPFFFS in isoform 4. 1 PublicationVSP_042885Add
BLAST
Alternative sequencei105 – 1051Q → M in isoform 5. 1 PublicationVSP_044299

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY116970 mRNA. Translation: AAM77213.1.
AK024966 mRNA. Translation: BAB15045.1.
AK293307 mRNA. Translation: BAH11488.1.
AK296267 mRNA. Translation: BAH12297.1.
AK300154 mRNA. Translation: BAH13224.1.
AK303857 mRNA. Translation: BAH14068.1.
AK316288 mRNA. Translation: BAH14659.1.
AC008546 Genomic DNA. No translation available.
AC093535 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48852.1.
CH471086 Genomic DNA. Translation: EAW48854.1.
CH471086 Genomic DNA. Translation: EAW48855.1.
BC008590 mRNA. Translation: AAH08590.1.
CCDSiCCDS4136.1. [Q96HH9-1]
CCDS54891.1. [Q96HH9-3]
CCDS54892.1. [Q96HH9-2]
CCDS54893.1. [Q96HH9-4]
CCDS54894.1. [Q96HH9-5]
RefSeqiNP_001139791.1. NM_001146319.1. [Q96HH9-3]
NP_001139792.1. NM_001146320.1. [Q96HH9-5]
NP_001139793.1. NM_001146321.1. [Q96HH9-2]
NP_001139794.1. NM_001146322.1. [Q96HH9-4]
NP_076416.2. NM_023927.2. [Q96HH9-1]
XP_005272120.1. XM_005272063.2. [Q96HH9-4]
UniGeneiHs.363558.

Genome annotation databases

EnsembliENST00000285689; ENSP00000285689; ENSG00000155324. [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324. [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324. [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324. [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324. [Q96HH9-5]
GeneIDi65983.
KEGGihsa:65983.
UCSCiuc003ktu.4. human. [Q96HH9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY116970 mRNA. Translation: AAM77213.1.
AK024966 mRNA. Translation: BAB15045.1.
AK293307 mRNA. Translation: BAH11488.1.
AK296267 mRNA. Translation: BAH12297.1.
AK300154 mRNA. Translation: BAH13224.1.
AK303857 mRNA. Translation: BAH14068.1.
AK316288 mRNA. Translation: BAH14659.1.
AC008546 Genomic DNA. No translation available.
AC093535 Genomic DNA. No translation available.
CH471086 Genomic DNA. Translation: EAW48852.1.
CH471086 Genomic DNA. Translation: EAW48854.1.
CH471086 Genomic DNA. Translation: EAW48855.1.
BC008590 mRNA. Translation: AAH08590.1.
CCDSiCCDS4136.1. [Q96HH9-1]
CCDS54891.1. [Q96HH9-3]
CCDS54892.1. [Q96HH9-2]
CCDS54893.1. [Q96HH9-4]
CCDS54894.1. [Q96HH9-5]
RefSeqiNP_001139791.1. NM_001146319.1. [Q96HH9-3]
NP_001139792.1. NM_001146320.1. [Q96HH9-5]
NP_001139793.1. NM_001146321.1. [Q96HH9-2]
NP_001139794.1. NM_001146322.1. [Q96HH9-4]
NP_076416.2. NM_023927.2. [Q96HH9-1]
XP_005272120.1. XM_005272063.2. [Q96HH9-4]
UniGeneiHs.363558.

3D structure databases

ProteinModelPortaliQ96HH9.
SMRiQ96HH9. Positions 109-215.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122433. 23 interactions.
IntActiQ96HH9. 7 interactions.
STRINGi9606.ENSP00000426120.

PTM databases

iPTMnetiQ96HH9.
PhosphoSiteiQ96HH9.

Polymorphism and mutation databases

BioMutaiGRAMD3.
DMDMi74731934.

Proteomic databases

EPDiQ96HH9.
MaxQBiQ96HH9.
PaxDbiQ96HH9.
PRIDEiQ96HH9.

Protocols and materials databases

DNASUi65983.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000285689; ENSP00000285689; ENSG00000155324. [Q96HH9-1]
ENST00000511134; ENSP00000426088; ENSG00000155324. [Q96HH9-4]
ENST00000513040; ENSP00000426120; ENSG00000155324. [Q96HH9-3]
ENST00000542322; ENSP00000441876; ENSG00000155324. [Q96HH9-2]
ENST00000544396; ENSP00000444049; ENSG00000155324. [Q96HH9-5]
GeneIDi65983.
KEGGihsa:65983.
UCSCiuc003ktu.4. human. [Q96HH9-1]

Organism-specific databases

CTDi65983.
GeneCardsiGRAMD3.
HGNCiHGNC:24911. GRAMD3.
HPAiHPA009678.
HPA010095.
neXtProtiNX_Q96HH9.
PharmGKBiPA142671711.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IRAJ. Eukaryota.
ENOG4111H65. LUCA.
GeneTreeiENSGT00580000081380.
HOGENOMiHOG000082410.
HOVERGENiHBG055715.
InParanoidiQ96HH9.
OMAiHEERDSH.
OrthoDBiEOG77Q4W0.
PhylomeDBiQ96HH9.
TreeFamiTF332065.

Miscellaneous databases

ChiTaRSiGRAMD3. human.
GenomeRNAii65983.
NextBioi67447.
PROiQ96HH9.

Gene expression databases

BgeeiQ96HH9.
CleanExiHS_GRAMD3.
ExpressionAtlasiQ96HH9. baseline and differential.
GenevisibleiQ96HH9. HS.

Family and domain databases

InterProiIPR004182. GRAM.
[Graphical view]
PfamiPF02893. GRAM. 1 hit.
[Graphical view]
SMARTiSM00568. GRAM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and identification of human gene 2 transactivated by hepatitis C virus NS3 protein."
    Liu Y., Cheng J., Mu J., Wang G., Zhang L., Chen J., Li L.
    Submitted (JUN-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Tissue: Colon, Placenta, Thalamus and Trachea.
  3. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-252, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis."
    Cantin G.T., Yi W., Lu B., Park S.K., Xu T., Lee J.-D., Yates J.R. III
    J. Proteome Res. 7:1346-1351(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-252, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-252, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-252, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiGRAM3_HUMAN
AccessioniPrimary (citable) accession number: Q96HH9
Secondary accession number(s): B7Z1F2
, B7Z3R1, B7Z6D8, B7Z8T2, D3DSZ3, Q9H753
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 6, 2005
Last sequence update: December 1, 2001
Last modified: May 11, 2016
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.