Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PDZ and LIM domain protein 5

Gene

PDLIM5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May play an important role in the heart development by scaffolding PKC to the Z-disk region. May play a role in the regulation of cardiomyocyte expansion. Overexpression promotes the development of heart hypertrophy. Contributes to the regulation of dendritic spine morphogenesis in neurons. May restrain postsynaptic growth of excitatory synapses (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PDZ and LIM domain protein 5
Alternative name(s):
Enigma homolog
Enigma-like PDZ and LIM domains protein
Gene namesi
Name:PDLIM5
Synonyms:ENH
ORF Names:L9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

HGNCiHGNC:17468. PDLIM5.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Postsynaptic cell membrane, Synapse, Synaptosome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134917248.

Polymorphism and mutation databases

BioMutaiPDLIM5.
DMDMi317373590.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Initiator methionineiRemovedCombined sources1 Publication
Chaini2 – 596595PDZ and LIM domain protein 5PRO_0000075877Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei2 – 21N-acetylserineCombined sources1 Publication
Modified residuei2 – 21PhosphoserineBy similarity
Modified residuei89 – 891N6-acetyllysine; alternateBy similarity
Modified residuei89 – 891N6-succinyllysine; alternateBy similarity
Modified residuei111 – 1111PhosphoserineCombined sources
Modified residuei137 – 1371PhosphoserineCombined sources
Modified residuei228 – 2281PhosphoserineBy similarity
Modified residuei309 – 3091PhosphoserineCombined sources
Modified residuei313 – 3131PhosphoserineCombined sources
Modified residuei322 – 3221PhosphoserineBy similarity
Modified residuei350 – 3501N6-acetyllysineBy similarity
Modified residuei360 – 3601PhosphoserineCombined sources

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96HC4.
MaxQBiQ96HC4.
PaxDbiQ96HC4.
PRIDEiQ96HC4.

PTM databases

iPTMnetiQ96HC4.
PhosphoSiteiQ96HC4.
SwissPalmiQ96HC4.

Expressioni

Tissue specificityi

Heart and skeletal muscle specific. Expression is commonly increased in the brain of patients with bipolar disorder, schizophrenia, and major depression.3 Publications

Gene expression databases

BgeeiQ96HC4.
CleanExiHS_PDLIM5.
ExpressionAtlasiQ96HC4. baseline and differential.
GenevisibleiQ96HC4. HS.

Organism-specific databases

HPAiCAB013511.
HPA016740.
HPA020026.

Interactioni

Subunit structurei

Interacts with various PKC isoforms through the LIM domains. Interacts (via LIM domains) with SIPA1L1. Interacts (via PDZ domain) with actin and ACTN1 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC136Q96JN2-23EBI-751267,EBI-10171416
COILP384323EBI-751267,EBI-945751
KRT40Q6A1623EBI-751267,EBI-10171697
KRTAP10-7P604093EBI-751267,EBI-10172290
ZYXQ159423EBI-751267,EBI-444225

GO - Molecular functioni

Protein-protein interaction databases

BioGridi115857. 57 interactions.
DIPiDIP-34898N.
IntActiQ96HC4. 15 interactions.
MINTiMINT-2868566.
STRINGi9606.ENSP00000321746.

Structurei

Secondary structure

1
596
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi3 – 1210Combined sources
Beta strandi16 – 216Combined sources
Helixi22 – 243Combined sources
Beta strandi26 – 338Combined sources
Helixi38 – 414Combined sources
Beta strandi49 – 535Combined sources
Helixi63 – 719Combined sources
Beta strandi75 – 828Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DARNMR-A400-476[»]
2UZCX-ray1.50A/B/C/D/E1-83[»]
ProteinModelPortaliQ96HC4.
SMRiQ96HC4. Positions 1-85, 400-592.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96HC4.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini2 – 8584PDZPROSITE-ProRule annotationAdd
BLAST
Domaini418 – 47760LIM zinc-binding 1PROSITE-ProRule annotationAdd
BLAST
Domaini477 – 53660LIM zinc-binding 2PROSITE-ProRule annotationAdd
BLAST
Domaini536 – 59661LIM zinc-binding 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 LIM zinc-binding domains.PROSITE-ProRule annotation
Contains 1 PDZ (DHR) domain.PROSITE-ProRule annotation

Keywords - Domaini

LIM domain, Repeat

Phylogenomic databases

eggNOGiKOG1703. Eukaryota.
ENOG410XRD4. LUCA.
GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG056486.
InParanoidiQ96HC4.
OMAiCNETITG.
OrthoDBiEOG7HXCQB.
PhylomeDBiQ96HC4.
TreeFamiTF106408.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HC4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSNYSVSLVG PAPWGFRLQG GKDFNMPLTI SSLKDGGKAA QANVRIGDVV
60 70 80 90 100
LSIDGINAQG MTHLEAQNKI KGCTGSLNMT LQRASAAPKP EPVPVQKGEP
110 120 130 140 150
KEVVKPVPIT SPAVSKVTST NNMAYNKAPR PFGSVSSPKV TSIPSPSSAF
160 170 180 190 200
TPAHATTSSH ASPSPVAAVT PPLFAASGLH ANANLSADQS PSALSAGKTA
210 220 230 240 250
VNVPRQPTVT SVCSETSQEL AEGQRRGSQG DSKQQNGPPR KHIVERYTEF
260 270 280 290 300
YHVPTHSDAS KKRLIEDTED WRPRTGTTQS RSFRILAQIT GTEHLKESEA
310 320 330 340 350
DNTKKANNSQ EPSPQLASSV ASTRSMPESL DSPTSGRPGV TSLTAAAAFK
360 370 380 390 400
PVGSTGVIKS PSWQRPNQGV PSTGRISNSA TYSGSVAPAN SALGQTQPSD
410 420 430 440 450
QDTLVQRAEH IPAGKRTPMC AHCNQVIRGP FLVALGKSWH PEEFNCAHCK
460 470 480 490 500
NTMAYIGFVE EKGALYCELC YEKFFAPECG RCQRKILGEV ISALKQTWHV
510 520 530 540 550
SCFVCVACGK PIRNNVFHLE DGEPYCETDY YALFGTICHG CEFPIEAGDM
560 570 580 590
FLEALGYTWH DTCFVCSVCC ESLEGQTFFS KKDKPLCKKH AHSVNF
Length:596
Mass (Da):63,945
Last modified:January 11, 2011 - v5
Checksum:iBBEAB9EDFA060736
GO
Isoform 2 (identifier: Q96HC4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     307-337: NNSQEPSPQLASSVASTRSMPESLDSPTSGR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-596: Missing.

Show »
Length:234
Mass (Da):25,930
Checksum:iAC29AA4B14829C09
GO
Isoform 3 (identifier: Q96HC4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-117: GEPKEVVKPVPITSPAVSKV → KTQVTNNPGTVKIPPKRPPR
     118-240: Missing.
     307-337: NNSQEPSPQLASSVASTRSMPESLDSPTSGR → KEKIPLHVFSPKYTKLRDWHHEVSARALNVQ
     338-596: Missing.

Show »
Length:214
Mass (Da):23,823
Checksum:iFB118BF53EE7CDB4
GO
Isoform 4 (identifier: Q96HC4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.

Note: No experimental confirmation available.
Show »
Length:487
Mass (Da):53,078
Checksum:i2790407D3FF2DED5
GO
Isoform 5 (identifier: Q96HC4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-136: LKDGGKAAQA...KAPRPFGSVS → AGVQWRNLGS...ATIYPEIILY
     137-596: Missing.

Show »
Length:136
Mass (Da):15,116
Checksum:i33801E4A7B117739
GO
Isoform 6 (identifier: Q96HC4-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     307-307: N → KFDSALEDLP...TGSIHVKKTS

Note: No experimental confirmation available.
Show »
Length:625
Mass (Da):67,729
Checksum:iFA6C01ACAE8B48B0
GO
Isoform 7 (identifier: Q96HC4-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     98-206: Missing.
     237-237: G → GKIPPKR
     587-596: Missing.

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):52,645
Checksum:iFE2F3A27E1EBFC11
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Isoform 2 (identifier: Q96HC4-2)
Sequence conflicti221 – 2211D → G in AL833438 (Ref. 6) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti136 – 1361S → F.1 Publication
Corresponds to variant rs2452600 [ dbSNP | Ensembl ].
VAR_023779
Natural varianti319 – 3191S → L.2 Publications
Corresponds to variant rs1064238 [ dbSNP | Ensembl ].
VAR_046662
Natural varianti345 – 3451A → T.6 Publications
Corresponds to variant rs966845 [ dbSNP | Ensembl ].
VAR_046663
Natural varianti381 – 3811T → A.3 Publications
Corresponds to variant rs7690296 [ dbSNP | Ensembl ].
VAR_046664
Natural varianti388 – 3881P → S.
Corresponds to variant rs7690464 [ dbSNP | Ensembl ].
VAR_046665
Natural varianti492 – 4921S → N.Combined sources6 Publications
Corresponds to variant rs13107595 [ dbSNP | Ensembl ].
VAR_046666

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei33 – 136104LKDGG…FGSVS → AGVQWRNLGSPQPPSPEFKR FSCLSLPSSWDYRHVPPRLA NFVFLVETKFPYVGQAGLEL PTSGDLPTSASQSAKITGVS HRAWPTLFYTLLFFATIYPE IILY in isoform 5. 1 PublicationVSP_045098Add
BLAST
Alternative sequencei98 – 206109Missing in isoform 2, isoform 4, isoform 6 and isoform 7. 2 PublicationsVSP_039075Add
BLAST
Alternative sequencei98 – 11720GEPKE…AVSKV → KTQVTNNPGTVKIPPKRPPR in isoform 3. 2 PublicationsVSP_039206Add
BLAST
Alternative sequencei118 – 240123Missing in isoform 3. 2 PublicationsVSP_039207Add
BLAST
Alternative sequencei137 – 596460Missing in isoform 5. 1 PublicationVSP_045099Add
BLAST
Alternative sequencei237 – 2371G → GKIPPKR in isoform 2, isoform 6 and isoform 7. 1 PublicationVSP_039076
Alternative sequencei307 – 33731NNSQE…PTSGR → KEKIPLHVFSPKYTKLRDWH HEVSARALNVQ in isoform 2 and isoform 3. 3 PublicationsVSP_039077Add
BLAST
Alternative sequencei307 – 3071N → KFDSALEDLPKSGPHPPATP QVLTIGSQVATLSKVATTYS SLSSSTGNVEDSFEGFRNFS TFSSPARYSAAVLSSAAATV SAVIATKTRLYTPERYHSLL DALCISPVSKPLAFSYLQSS RKSTGSIHVKKTS in isoform 6. CuratedVSP_053796
Alternative sequencei338 – 596259Missing in isoform 2 and isoform 3. 3 PublicationsVSP_039078Add
BLAST
Alternative sequencei587 – 59610Missing in isoform 7. CuratedVSP_053797

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF061258 mRNA. Translation: AAC15767.1.
AY345240 mRNA. Translation: AAR09142.1.
AY598328 mRNA. Translation: AAT06739.1.
BT007328 mRNA. Translation: AAP35992.1.
AK291624 mRNA. Translation: BAF84313.1.
AK291898 mRNA. Translation: BAF84587.1.
CR610626 mRNA. No translation available.
AL833438 mRNA. No translation available.
AC093778 Genomic DNA. No translation available.
AC108067 Genomic DNA. No translation available.
AC109925 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06054.1.
BC017902 mRNA. Translation: AAH17902.1.
BC008741 mRNA. Translation: AAH08741.1.
CCDSiCCDS3641.1. [Q96HC4-1]
CCDS47102.1. [Q96HC4-4]
CCDS47103.1. [Q96HC4-2]
CCDS47104.1. [Q96HC4-3]
CCDS58915.1. [Q96HC4-5]
CCDS58916.1. [Q96HC4-6]
CCDS58917.1. [Q96HC4-7]
RefSeqiNP_001011515.1. NM_001011515.2. [Q96HC4-2]
NP_001011516.1. NM_001011516.2. [Q96HC4-3]
NP_001243358.1. NM_001256429.1. [Q96HC4-5]
NP_006448.4. NM_006457.4.
UniGeneiHs.480311.
Hs.732677.

Genome annotation databases

EnsembliENST00000317968; ENSP00000321746; ENSG00000163110. [Q96HC4-1]
ENST00000318007; ENSP00000322021; ENSG00000163110. [Q96HC4-3]
ENST00000359265; ENSP00000352210; ENSG00000163110. [Q96HC4-5]
ENST00000380180; ENSP00000369527; ENSG00000163110. [Q96HC4-2]
ENST00000503974; ENSP00000424297; ENSG00000163110. [Q96HC4-7]
ENST00000508216; ENSP00000426804; ENSG00000163110. [Q96HC4-2]
ENST00000514743; ENSP00000424360; ENSG00000163110. [Q96HC4-6]
ENST00000542407; ENSP00000442187; ENSG00000163110. [Q96HC4-4]
ENST00000615540; ENSP00000480359; ENSG00000163110. [Q96HC4-6]
GeneIDi10611.
UCSCiuc003htf.5. human. [Q96HC4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF061258 mRNA. Translation: AAC15767.1.
AY345240 mRNA. Translation: AAR09142.1.
AY598328 mRNA. Translation: AAT06739.1.
BT007328 mRNA. Translation: AAP35992.1.
AK291624 mRNA. Translation: BAF84313.1.
AK291898 mRNA. Translation: BAF84587.1.
CR610626 mRNA. No translation available.
AL833438 mRNA. No translation available.
AC093778 Genomic DNA. No translation available.
AC108067 Genomic DNA. No translation available.
AC109925 Genomic DNA. No translation available.
CH471057 Genomic DNA. Translation: EAX06054.1.
BC017902 mRNA. Translation: AAH17902.1.
BC008741 mRNA. Translation: AAH08741.1.
CCDSiCCDS3641.1. [Q96HC4-1]
CCDS47102.1. [Q96HC4-4]
CCDS47103.1. [Q96HC4-2]
CCDS47104.1. [Q96HC4-3]
CCDS58915.1. [Q96HC4-5]
CCDS58916.1. [Q96HC4-6]
CCDS58917.1. [Q96HC4-7]
RefSeqiNP_001011515.1. NM_001011515.2. [Q96HC4-2]
NP_001011516.1. NM_001011516.2. [Q96HC4-3]
NP_001243358.1. NM_001256429.1. [Q96HC4-5]
NP_006448.4. NM_006457.4.
UniGeneiHs.480311.
Hs.732677.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2DARNMR-A400-476[»]
2UZCX-ray1.50A/B/C/D/E1-83[»]
ProteinModelPortaliQ96HC4.
SMRiQ96HC4. Positions 1-85, 400-592.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi115857. 57 interactions.
DIPiDIP-34898N.
IntActiQ96HC4. 15 interactions.
MINTiMINT-2868566.
STRINGi9606.ENSP00000321746.

PTM databases

iPTMnetiQ96HC4.
PhosphoSiteiQ96HC4.
SwissPalmiQ96HC4.

Polymorphism and mutation databases

BioMutaiPDLIM5.
DMDMi317373590.

Proteomic databases

EPDiQ96HC4.
MaxQBiQ96HC4.
PaxDbiQ96HC4.
PRIDEiQ96HC4.

Protocols and materials databases

DNASUi10611.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000317968; ENSP00000321746; ENSG00000163110. [Q96HC4-1]
ENST00000318007; ENSP00000322021; ENSG00000163110. [Q96HC4-3]
ENST00000359265; ENSP00000352210; ENSG00000163110. [Q96HC4-5]
ENST00000380180; ENSP00000369527; ENSG00000163110. [Q96HC4-2]
ENST00000503974; ENSP00000424297; ENSG00000163110. [Q96HC4-7]
ENST00000508216; ENSP00000426804; ENSG00000163110. [Q96HC4-2]
ENST00000514743; ENSP00000424360; ENSG00000163110. [Q96HC4-6]
ENST00000542407; ENSP00000442187; ENSG00000163110. [Q96HC4-4]
ENST00000615540; ENSP00000480359; ENSG00000163110. [Q96HC4-6]
GeneIDi10611.
UCSCiuc003htf.5. human. [Q96HC4-1]

Organism-specific databases

CTDi10611.
GeneCardsiPDLIM5.
H-InvDBHIX0004384.
HIX0031573.
HGNCiHGNC:17468. PDLIM5.
HPAiCAB013511.
HPA016740.
HPA020026.
MIMi605904. gene.
neXtProtiNX_Q96HC4.
PharmGKBiPA134917248.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1703. Eukaryota.
ENOG410XRD4. LUCA.
GeneTreeiENSGT00760000118910.
HOGENOMiHOG000220936.
HOVERGENiHBG056486.
InParanoidiQ96HC4.
OMAiCNETITG.
OrthoDBiEOG7HXCQB.
PhylomeDBiQ96HC4.
TreeFamiTF106408.

Miscellaneous databases

ChiTaRSiPDLIM5. human.
EvolutionaryTraceiQ96HC4.
GeneWikiiPDLIM5.
GenomeRNAii10611.
NextBioi35493485.
PROiQ96HC4.
SOURCEiSearch...

Gene expression databases

BgeeiQ96HC4.
CleanExiHS_PDLIM5.
ExpressionAtlasiQ96HC4. baseline and differential.
GenevisibleiQ96HC4. HS.

Family and domain databases

Gene3Di2.10.110.10. 3 hits.
2.30.42.10. 1 hit.
InterProiIPR031847. DUF4749.
IPR001478. PDZ.
IPR001781. Znf_LIM.
[Graphical view]
PfamiPF15936. DUF4749. 1 hit.
PF00412. LIM. 3 hits.
PF00595. PDZ. 1 hit.
[Graphical view]
SMARTiSM00132. LIM. 3 hits.
SM00228. PDZ. 1 hit.
[Graphical view]
SUPFAMiSSF50156. SSF50156. 1 hit.
PROSITEiPS00478. LIM_DOMAIN_1. 2 hits.
PS50023. LIM_DOMAIN_2. 3 hits.
PS50106. PDZ. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Isolation, tissue expression, and chromosomal assignment of a human LIM protein gene, showing homology to rat enigma homologue (ENH)."
    Ueki N., Seki N., Yano K., Masuho Y., Saito T., Muramatsu M.
    J. Hum. Genet. 44:256-260(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANTS LEU-319; THR-345 AND ASN-492.
  2. "Cloning and identification of a novel human gene PDLIM5, a homolog of AD-associated neuronal thread protein (AD7c-NTP)."
    Wu M., Li Y., Ji C., Xu J., Zheng H., Zou X., Gu S., Lou Y., Xie Y., Mao Y.
    DNA Seq. 15:144-147(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5).
  3. "Suppression subtractive hybridization and expression profiling identifies a unique set of genes overexpressed in non-small-cell lung cancer."
    Petroziello J., Yamane A., Westendorf L., Thompson M., McDonagh C., Cerveny C., Law C.-L., Wahl A., Carter P.
    Oncogene 23:7734-7745(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANTS LEU-319; THR-345 AND ASN-492.
  4. "Cloning of human full-length CDSs in BD Creator(TM) system donor vector."
    Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A.
    Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS THR-345; ALA-381 AND ASN-492.
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS VARIANTS PHE-136; THR-345 AND ASN-492.
    Tissue: Placenta.
  6. "Full-length cDNA libraries and normalization."
    Li W.B., Gruber C., Jessee J., Polayes D.
    Submitted (JUL-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Placenta.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Heart.
  8. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANTS THR-345; ALA-381 AND ASN-492.
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANTS THR-345; ALA-381 AND ASN-492.
    Tissue: Skin.
  11. Bienvenut W.V., Claeys D.
    Submitted (NOV-2005) to UniProtKB
    Cited for: PROTEIN SEQUENCE OF 2-17 AND 84-97 (ISOFORMS 1/2), CLEAVAGE OF INITIATOR METHIONINE, ACETYLATION AT SER-2, IDENTIFICATION BY MASS SPECTROMETRY.
    Tissue: Platelet.
  12. "Gene expression and association analyses of LIM (PDLIM5) in bipolar disorder and schizophrenia."
    Kato T., Iwayama Y., Kakiuchi C., Iwamoto K., Yamada K., Minabe Y., Nakamura K., Mori N., Fujii K., Nanko S., Yoshikawa T.
    Mol. Psychiatry 10:1045-1055(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  13. "A polymorphism in the PDLIM5 gene associated with gene expression and schizophrenia."
    Horiuchi Y., Arai M., Niizato K., Iritani S., Noguchi E., Ohtsuki T., Koga M., Kato T., Itokawa M., Arinami T.
    Biol. Psychiatry 59:434-439(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  14. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-309 AND SER-313, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra."
    Yu L.R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.
    J. Proteome Res. 6:4150-4162(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  16. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-111; SER-137; SER-309 AND SER-313, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  17. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-111; SER-137; SER-309 AND SER-313, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  18. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-309, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  19. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS], IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  20. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT SER-2, CLEAVAGE OF INITIATOR METHIONINE [LARGE SCALE ANALYSIS], IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  21. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-313 AND SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  22. "Solution structure of first LIM domain of enigma-like PDZ and LIM domains protein."
    RIKEN structural genomics initiative (RSGI)
    Submitted (DEC-2006) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 400-476.
  23. "Unusual binding interactions in PDZ domain crystal structures help explain binding mechanisms."
    Elkins J.M., Gileadi C., Shrestha L., Phillips C., Wang J., Muniz J.R., Doyle D.A.
    Protein Sci. 19:731-741(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 1-83.
  24. Cited for: VARIANT [LARGE SCALE ANALYSIS] ASN-492, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiPDLI5_HUMAN
AccessioniPrimary (citable) accession number: Q96HC4
Secondary accession number(s): A8K6F9
, D6RB78, E9PBF5, O60705, Q56VN4, Q5UW38, Q8WVK0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 24, 2004
Last sequence update: January 11, 2011
Last modified: May 11, 2016
This is version 146 of the entry and version 5 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.