Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 120

Gene

CCDC120

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for neurite growth. Localizes CYTH2 to vesicles to allow its transport along neurites, and subsequent ARF6 activation and neurite growth.1 Publication

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 120
Gene namesi
Name:CCDC120
ORF Names:JM11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28910. CCDC120.

Subcellular locationi

GO - Cellular componenti

Keywords - Cellular componenti

Cell projection, Cytoplasm, Endosome

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000147144.
PharmGKBiPA145149329.

Polymorphism and mutation databases

DMDMi74731908.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002541411 – 630Coiled-coil domain-containing protein 120Add BLAST630

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei358PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1

Post-translational modificationi

Ubiquitinated; interaction with CYTH2 may prevent ubiquitination.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96HB5.
MaxQBiQ96HB5.
PaxDbiQ96HB5.
PeptideAtlasiQ96HB5.
PRIDEiQ96HB5.

PTM databases

iPTMnetiQ96HB5.
PhosphoSitePlusiQ96HB5.

Expressioni

Gene expression databases

BgeeiENSG00000147144.
CleanExiHS_CCDC120.
ExpressionAtlasiQ96HB5. baseline and differential.
GenevisibleiQ96HB5. HS.

Organism-specific databases

HPAiHPA000561.

Interactioni

Subunit structurei

Directly interacts with CYTH2; this interaction stabilizes CCDC120, possibly by preventing ubiquitination.1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124658. 63 interactors.
IntActiQ96HB5. 91 interactors.
STRINGi9606.ENSP00000416445.

Structurei

3D structure databases

ProteinModelPortaliQ96HB5.
SMRiQ96HB5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni31 – 70Involved in CYTH2-binding1 PublicationAdd BLAST40

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili109 – 173Sequence analysisAdd BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi377 – 543Pro-richAdd BLAST167

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3529. Eukaryota.
ENOG410XQFP. LUCA.
GeneTreeiENSGT00860000133727.
HOGENOMiHOG000231367.
HOVERGENiHBG080242.
InParanoidiQ96HB5.
OMAiDWYIRNS.
OrthoDBiEOG091G05R8.
PhylomeDBiQ96HB5.
TreeFamiTF328984.

Family and domain databases

InterProiView protein in InterPro
IPR021774. DUF3338.
PfamiView protein in Pfam
PF11819. DUF3338. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL
60 70 80 90 100
QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA
110 120 130 140 150
HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ
160 170 180 190 200
ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR
210 220 230 240 250
LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR
260 270 280 290 300
AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG
310 320 330 340 350
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL
360 370 380 390 400
FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER
410 420 430 440 450
PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD
460 470 480 490 500
RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL
510 520 530 540 550
LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG
560 570 580 590 600
HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA
610 620 630
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY
Length:630
Mass (Da):67,567
Last modified:December 1, 2001 - v1
Checksum:iE652C8AFD738BF6E
GO
Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):66,354
Checksum:i3BB9CCCF52CB53F0
GO
Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:661
Mass (Da):70,911
Checksum:i45084D2BED260DC9
GO
Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:696
Mass (Da):74,970
Checksum:iB9722ECBDF715B75
GO
Isoform 5 (identifier: Q96HB5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:649
Mass (Da):69,698
Checksum:i149F30E4292E9782
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0545271M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428595 – 16Missing in isoform 2 and isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_047104626 – 630GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3, isoform 4 and isoform 5. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ896186 mRNA. No translation available.
AK293898 mRNA. Translation: BAG57285.1.
AK294024 mRNA. Translation: BAG57382.1.
AK291370 mRNA. Translation: BAF84059.1.
AK300366 mRNA. Translation: BAG62104.1.
AK315837 mRNA. Translation: BAF98728.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50708.1.
BC008769 mRNA. Translation: AAH08769.1.
CCDSiCCDS14316.1. [Q96HB5-1]
CCDS55413.1. [Q96HB5-2]
CCDS55414.2. [Q96HB5-4]
RefSeqiNP_001156793.2. NM_001163321.2. [Q96HB5-4]
NP_001156794.1. NM_001163322.2. [Q96HB5-5]
NP_001156795.1. NM_001163323.2. [Q96HB5-2]
NP_001258764.1. NM_001271835.1. [Q96HB5-1]
NP_001258765.1. NM_001271836.1. [Q96HB5-1]
NP_296375.1. NM_033626.3. [Q96HB5-1]
UniGeneiHs.522643.

Genome annotation databases

EnsembliENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144. [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144. [Q96HB5-1]
GeneIDi90060.
KEGGihsa:90060.
UCSCiuc064zdh.1. human. [Q96HB5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.

Entry informationi

Entry nameiCC120_HUMAN
AccessioniPrimary (citable) accession number: Q96HB5
Secondary accession number(s): A8K5Q5
, B4DF24, B4DFC1, B4DTU2, F5GZU4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: July 5, 2017
This is version 115 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot