Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96HB5 (CC120_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 84. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (1) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Coiled-coil domain-containing protein 120
Gene names
Name:CCDC120
ORF Names:JM11
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length630 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96HB5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96HB5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96HB5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV
Note: No experimental confirmation available.
Isoform 4 (identifier: Q96HB5-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 630630Coiled-coil domain-containing protein 120
PRO_0000254141

Regions

Coiled coil109 – 17365 Potential
Compositional bias377 – 543167Pro-rich

Amino acid modifications

Modified residue3581Phosphoserine Ref.6
Modified residue3601Phosphoserine Ref.7

Natural variations

Alternative sequence11M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4.
VSP_054527
Alternative sequence5 – 1612Missing in isoform 2.
VSP_042859
Alternative sequence626 – 6305GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3 and isoform 4.
VSP_047104

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: E652C8AFD738BF6E

FASTA63067,567
        10         20         30         40         50         60 
MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL QELRKVCLQE 

        70         80         90        100        110        120 
AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA HHSLCPAEEL ALEALEREVS 

       130        140        150        160        170        180 
VQQQIAAAAR RLALAPDLST EQRRRRRQVQ ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ 

       190        200        210        220        230        240 
PLPLSTGSVI TTQGVCLGMR LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP 

       250        260        270        280        290        300 
SPPKAWDQLR AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG 

       310        320        330        340        350        360 
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL FVARTRRSNS 

       370        380        390        400        410        420 
SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER PQPTPAFSSR TAGPPDPPRA 

       430        440        450        460        470        480 
ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD RGLPRSGGGT GWGELPPAAE VPGPLSRRDG 

       490        500        510        520        530        540 
LLTMLPGPPP VYAADSNSPL LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT 

       550        560        570        580        590        600 
RIPSAGERSG HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA 

       610        620        630 
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY 

« Hide

Isoform 2 [UniParc].

Checksum: 3BB9CCCF52CB53F0
Show »

FASTA61866,354
Isoform 3 [UniParc].

Checksum: 45084D2BED260DC9
Show »

FASTA66170,911
Isoform 4 [UniParc].

Checksum: B9722ECBDF715B75
Show »

FASTA69674,970

References

[1]"Cloning of human full-length CDS FLEXGene in Gateway(TM) recombinational vector system."
Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y., Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.
Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
Tissue: Cerebellum and Placenta.
[3]"The DNA sequence of the human X chromosome."
Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. expand/collapse author list , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Choriocarcinoma.
[5]"ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage."
Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III, Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N., Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.
Science 316:1160-1166(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Embryonic kidney.
[6]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[7]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[8]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
DQ896186 mRNA. No translation available.
AK294024 mRNA. Translation: BAG57382.1.
AK300366 mRNA. Translation: BAG62104.1.
AF196779 Genomic DNA. No translation available.
BC008769 mRNA. Translation: AAH08769.1.
CCDSCCDS14316.1. [Q96HB5-1]
CCDS55413.1. [Q96HB5-2]
RefSeqNP_001156793.2. NM_001163321.2. [Q96HB5-4]
NP_001156794.1. NM_001163322.2.
NP_001156795.1. NM_001163323.2. [Q96HB5-2]
NP_001258764.1. NM_001271835.1. [Q96HB5-1]
NP_001258765.1. NM_001271836.1. [Q96HB5-1]
NP_296375.1. NM_033626.3. [Q96HB5-1]
UniGeneHs.522643.

3D structure databases

ProteinModelPortalQ96HB5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124658. 8 interactions.
IntActQ96HB5. 8 interactions.
STRING9606.ENSP00000365577.

PTM databases

PhosphoSiteQ96HB5.

Polymorphism databases

DMDM74731908.

Proteomic databases

MaxQBQ96HB5.
PaxDbQ96HB5.
PRIDEQ96HB5.

Protocols and materials databases

DNASU90060.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000376396; ENSP00000365577; ENSG00000147144. [Q96HB5-1]
ENST00000422185; ENSP00000416445; ENSG00000147144. [Q96HB5-3]
ENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144.
GeneID90060.
KEGGhsa:90060.
UCSCuc004dmf.4. human. [Q96HB5-1]
uc011mms.3. human. [Q96HB5-2]

Organism-specific databases

CTD90060.
GeneCardsGC0XP048916.
HGNCHGNC:28910. CCDC120.
HPAHPA000561.
neXtProtNX_Q96HB5.
PharmGKBPA145149329.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG119122.
HOGENOMHOG000231367.
HOVERGENHBG080242.
InParanoidQ96HB5.
OMAINGHTEL.
OrthoDBEOG70KGP5.
PhylomeDBQ96HB5.
TreeFamTF328984.

Gene expression databases

ArrayExpressQ96HB5.
BgeeQ96HB5.
CleanExHS_CCDC120.
GenevestigatorQ96HB5.

Family and domain databases

InterProIPR021774. DUF3338.
[Graphical view]
PfamPF11819. DUF3338. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSCCDC120. human.
GenomeRNAi90060.
NextBio76501.
PROQ96HB5.

Entry information

Entry nameCC120_HUMAN
AccessionPrimary (citable) accession number: Q96HB5
Secondary accession number(s): B4DFC1, B4DTU2, F5GZU4
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM