Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96HB5

- CC120_HUMAN

UniProt

Q96HB5 - CC120_HUMAN

Protein

Coiled-coil domain-containing protein 120

Gene

CCDC120

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 86 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Coiled-coil domain-containing protein 120
    Gene namesi
    Name:CCDC120
    ORF Names:JM11
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:28910. CCDC120.

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145149329.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 630630Coiled-coil domain-containing protein 120PRO_0000254141Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei358 – 3581Phosphoserine1 Publication
    Modified residuei360 – 3601Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ96HB5.
    PaxDbiQ96HB5.
    PRIDEiQ96HB5.

    PTM databases

    PhosphoSiteiQ96HB5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96HB5.
    BgeeiQ96HB5.
    CleanExiHS_CCDC120.
    GenevestigatoriQ96HB5.

    Organism-specific databases

    HPAiHPA000561.

    Interactioni

    Protein-protein interaction databases

    BioGridi124658. 8 interactions.
    IntActiQ96HB5. 8 interactions.
    STRINGi9606.ENSP00000365577.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96HB5.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili109 – 17365Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi377 – 543167Pro-richAdd
    BLAST

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG119122.
    HOGENOMiHOG000231367.
    HOVERGENiHBG080242.
    InParanoidiQ96HB5.
    OMAiINGHTEL.
    OrthoDBiEOG70KGP5.
    PhylomeDBiQ96HB5.
    TreeFamiTF328984.

    Family and domain databases

    InterProiIPR021774. DUF3338.
    [Graphical view]
    PfamiPF11819. DUF3338. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL    50
    QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA 100
    HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ 150
    ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR 200
    LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR 250
    AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG 300
    RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL 350
    FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER 400
    PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD 450
    RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL 500
    LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG 550
    HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA 600
    LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY 630
    Length:630
    Mass (Da):67,567
    Last modified:December 1, 2001 - v1
    Checksum:iE652C8AFD738BF6E
    GO
    Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         5-16: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:618
    Mass (Da):66,354
    Checksum:i3BB9CCCF52CB53F0
    GO
    Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

    Note: No experimental confirmation available.

    Show »
    Length:661
    Mass (Da):70,911
    Checksum:i45084D2BED260DC9
    GO
    Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
         626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

    Note: No experimental confirmation available.

    Show »
    Length:696
    Mass (Da):74,970
    Checksum:iB9722ECBDF715B75
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4. 1 PublicationVSP_054527
    Alternative sequencei5 – 1612Missing in isoform 2. 1 PublicationVSP_042859Add
    BLAST
    Alternative sequencei626 – 6305GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3 and isoform 4. 1 PublicationVSP_047104

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ896186 mRNA. No translation available.
    AK294024 mRNA. Translation: BAG57382.1.
    AK300366 mRNA. Translation: BAG62104.1.
    AF196779 Genomic DNA. No translation available.
    BC008769 mRNA. Translation: AAH08769.1.
    CCDSiCCDS14316.1. [Q96HB5-1]
    CCDS55413.1. [Q96HB5-2]
    CCDS55414.2. [Q96HB5-4]
    RefSeqiNP_001156793.2. NM_001163321.2. [Q96HB5-4]
    NP_001156794.1. NM_001163322.2.
    NP_001156795.1. NM_001163323.2. [Q96HB5-2]
    NP_001258764.1. NM_001271835.1. [Q96HB5-1]
    NP_001258765.1. NM_001271836.1. [Q96HB5-1]
    NP_296375.1. NM_033626.3. [Q96HB5-1]
    UniGeneiHs.522643.

    Genome annotation databases

    EnsembliENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
    ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
    ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
    ENST00000603986; ENSP00000474071; ENSG00000147144. [Q96HB5-4]
    ENST00000606812; ENSP00000475676; ENSG00000147144. [Q96HB5-1]
    GeneIDi90060.
    KEGGihsa:90060.
    UCSCiuc004dmf.4. human. [Q96HB5-1]
    uc011mms.3. human. [Q96HB5-2]

    Polymorphism databases

    DMDMi74731908.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ896186 mRNA. No translation available.
    AK294024 mRNA. Translation: BAG57382.1 .
    AK300366 mRNA. Translation: BAG62104.1 .
    AF196779 Genomic DNA. No translation available.
    BC008769 mRNA. Translation: AAH08769.1 .
    CCDSi CCDS14316.1. [Q96HB5-1 ]
    CCDS55413.1. [Q96HB5-2 ]
    CCDS55414.2. [Q96HB5-4 ]
    RefSeqi NP_001156793.2. NM_001163321.2. [Q96HB5-4 ]
    NP_001156794.1. NM_001163322.2.
    NP_001156795.1. NM_001163323.2. [Q96HB5-2 ]
    NP_001258764.1. NM_001271835.1. [Q96HB5-1 ]
    NP_001258765.1. NM_001271836.1. [Q96HB5-1 ]
    NP_296375.1. NM_033626.3. [Q96HB5-1 ]
    UniGenei Hs.522643.

    3D structure databases

    ProteinModelPortali Q96HB5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124658. 8 interactions.
    IntActi Q96HB5. 8 interactions.
    STRINGi 9606.ENSP00000365577.

    PTM databases

    PhosphoSitei Q96HB5.

    Polymorphism databases

    DMDMi 74731908.

    Proteomic databases

    MaxQBi Q96HB5.
    PaxDbi Q96HB5.
    PRIDEi Q96HB5.

    Protocols and materials databases

    DNASUi 90060.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000496529 ; ENSP00000474761 ; ENSG00000147144 . [Q96HB5-1 ]
    ENST00000536628 ; ENSP00000443351 ; ENSG00000147144 . [Q96HB5-2 ]
    ENST00000597275 ; ENSP00000470294 ; ENSG00000147144 . [Q96HB5-1 ]
    ENST00000603986 ; ENSP00000474071 ; ENSG00000147144 . [Q96HB5-4 ]
    ENST00000606812 ; ENSP00000475676 ; ENSG00000147144 . [Q96HB5-1 ]
    GeneIDi 90060.
    KEGGi hsa:90060.
    UCSCi uc004dmf.4. human. [Q96HB5-1 ]
    uc011mms.3. human. [Q96HB5-2 ]

    Organism-specific databases

    CTDi 90060.
    GeneCardsi GC0XP048916.
    HGNCi HGNC:28910. CCDC120.
    HPAi HPA000561.
    neXtProti NX_Q96HB5.
    PharmGKBi PA145149329.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG119122.
    HOGENOMi HOG000231367.
    HOVERGENi HBG080242.
    InParanoidi Q96HB5.
    OMAi INGHTEL.
    OrthoDBi EOG70KGP5.
    PhylomeDBi Q96HB5.
    TreeFami TF328984.

    Miscellaneous databases

    ChiTaRSi CCDC120. human.
    GenomeRNAii 90060.
    NextBioi 76501.
    PROi Q96HB5.

    Gene expression databases

    ArrayExpressi Q96HB5.
    Bgeei Q96HB5.
    CleanExi HS_CCDC120.
    Genevestigatori Q96HB5.

    Family and domain databases

    InterProi IPR021774. DUF3338.
    [Graphical view ]
    Pfami PF11819. DUF3338. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning of human full-length CDS FLEXGene in Gateway(TM) recombinational vector system."
      Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y., Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.
      Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
      Tissue: Cerebellum and Placenta.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Choriocarcinoma.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Embryonic kidney.
    6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiCC120_HUMAN
    AccessioniPrimary (citable) accession number: Q96HB5
    Secondary accession number(s): B4DFC1, B4DTU2, F5GZU4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 86 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM

    External Data

    Dasty 3