Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 120

Gene

CCDC120

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Centriolar protein required for centriole subdistal appendage assembly and microtubule anchoring in interphase cells (PubMed:28422092). Together with CCDC68, cooperate with subdistal appendage components ODF2, NIN and CEP170 for hierarchical subdistal appendage assembly (PubMed:28422092). Recruits NIN and CEP170 to centrosomes (PubMed:28422092). Also required for neurite growth. Localizes CYTH2 to vesicles to allow its transport along neurites, and subsequent ARF6 activation and neurite growth.1 Publication

GO - Biological processi

  • microtubule anchoring at centrosome Source: GO_Central
  • multicellular organism development Source: UniProtKB-KW
  • protein localization Source: GO_Central

Keywordsi

Molecular functionDevelopmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 120
Gene namesi
Name:CCDC120
ORF Names:JM11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000147144.12
HGNCiHGNC:28910 CCDC120
MIMi300947 gene
neXtProtiNX_Q96HB5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm, Cytoskeleton, Endosome

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000147144
PharmGKBiPA145149329

Polymorphism and mutation databases

DMDMi74731908

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002541411 – 630Coiled-coil domain-containing protein 120Add BLAST630

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei358PhosphoserineCombined sources1
Modified residuei360PhosphoserineCombined sources1
Modified residuei435Omega-N-methylarginineBy similarity1

Post-translational modificationi

Ubiquitinated; interaction with CYTH2 may prevent ubiquitination.1 Publication

Keywords - PTMi

Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96HB5
MaxQBiQ96HB5
PaxDbiQ96HB5
PeptideAtlasiQ96HB5
PRIDEiQ96HB5

PTM databases

iPTMnetiQ96HB5
PhosphoSitePlusiQ96HB5

Expressioni

Gene expression databases

BgeeiENSG00000147144
CleanExiHS_CCDC120
ExpressionAtlasiQ96HB5 baseline and differential
GenevisibleiQ96HB5 HS

Organism-specific databases

HPAiHPA000561

Interactioni

Subunit structurei

Interacts with NIN and CEP170; leading to recruit them to centrosomes (PubMed:28422092). Directly interacts with CYTH2; this interaction stabilizes CCDC120, possibly by preventing ubiquitination.2 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124658, 71 interactors
IntActiQ96HB5, 91 interactors
MINTiQ96HB5
STRINGi9606.ENSP00000416445

Structurei

3D structure databases

ProteinModelPortaliQ96HB5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni31 – 70Involved in CYTH2-binding1 PublicationAdd BLAST40

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili109 – 173Sequence analysisAdd BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi377 – 543Pro-richAdd BLAST167

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG3529 Eukaryota
ENOG410XQFP LUCA
GeneTreeiENSGT00890000139541
HOGENOMiHOG000231367
HOVERGENiHBG080242
InParanoidiQ96HB5
OMAiDWYIRNS
OrthoDBiEOG091G05R8
PhylomeDBiQ96HB5
TreeFamiTF328984

Family and domain databases

InterProiView protein in InterPro
IPR021774 DUF3338
PfamiView protein in Pfam
PF11819 DUF3338, 1 hit

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL
60 70 80 90 100
QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA
110 120 130 140 150
HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ
160 170 180 190 200
ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR
210 220 230 240 250
LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR
260 270 280 290 300
AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG
310 320 330 340 350
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL
360 370 380 390 400
FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER
410 420 430 440 450
PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD
460 470 480 490 500
RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL
510 520 530 540 550
LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG
560 570 580 590 600
HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA
610 620 630
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY
Length:630
Mass (Da):67,567
Last modified:December 1, 2001 - v1
Checksum:iE652C8AFD738BF6E
GO
Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):66,354
Checksum:i3BB9CCCF52CB53F0
GO
Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:661
Mass (Da):70,911
Checksum:i45084D2BED260DC9
GO
Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:696
Mass (Da):74,970
Checksum:iB9722ECBDF715B75
GO
Isoform 5 (identifier: Q96HB5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:649
Mass (Da):69,698
Checksum:i149F30E4292E9782
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0545271M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4. 1 Publication1
Alternative sequenceiVSP_0428595 – 16Missing in isoform 2 and isoform 5. 1 PublicationAdd BLAST12
Alternative sequenceiVSP_047104626 – 630GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3, isoform 4 and isoform 5. 1 Publication5

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ896186 mRNA No translation available.
AK293898 mRNA Translation: BAG57285.1
AK294024 mRNA Translation: BAG57382.1
AK291370 mRNA Translation: BAF84059.1
AK300366 mRNA Translation: BAG62104.1
AK315837 mRNA Translation: BAF98728.1
AF196779 Genomic DNA No translation available.
CH471224 Genomic DNA Translation: EAW50708.1
BC008769 mRNA Translation: AAH08769.1
CCDSiCCDS14316.1 [Q96HB5-1]
CCDS55413.1 [Q96HB5-2]
CCDS55414.2 [Q96HB5-4]
RefSeqiNP_001156793.2, NM_001163321.2 [Q96HB5-4]
NP_001156794.1, NM_001163322.2 [Q96HB5-5]
NP_001156795.1, NM_001163323.2 [Q96HB5-2]
NP_001258764.1, NM_001271835.1 [Q96HB5-1]
NP_001258765.1, NM_001271836.1 [Q96HB5-1]
NP_296375.1, NM_033626.3 [Q96HB5-1]
UniGeneiHs.522643

Genome annotation databases

EnsembliENST00000496529; ENSP00000474761; ENSG00000147144 [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144 [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144 [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144 [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144 [Q96HB5-1]
GeneIDi90060
KEGGihsa:90060
UCSCiuc064zdh.1 human [Q96HB5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCC120_HUMAN
AccessioniPrimary (citable) accession number: Q96HB5
Secondary accession number(s): A8K5Q5
, B4DF24, B4DFC1, B4DTU2, F5GZU4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: April 25, 2018
This is version 122 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health