Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Coiled-coil domain-containing protein 120

Gene

CCDC120

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for neurite growth. Localizes CYTH2 to vesicles to allow its transport along neurites, and subsequent ARF6 activation and neurite growth.1 Publication

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 120
Gene namesi
Name:CCDC120
ORF Names:JM11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28910. CCDC120.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell projection, Cytoplasm, Endosome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145149329.

Polymorphism and mutation databases

DMDMi74731908.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 630630Coiled-coil domain-containing protein 120PRO_0000254141Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei358 – 3581Phosphoserine1 Publication
Modified residuei360 – 3601Phosphoserine1 Publication

Post-translational modificationi

Ubiquitinated; interaction with CYTH2 may prevent ubiquitination.1 Publication

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ96HB5.
PaxDbiQ96HB5.
PRIDEiQ96HB5.

PTM databases

PhosphoSiteiQ96HB5.

Expressioni

Gene expression databases

BgeeiQ96HB5.
CleanExiHS_CCDC120.
ExpressionAtlasiQ96HB5. baseline and differential.
GenevisibleiQ96HB5. HS.

Organism-specific databases

HPAiHPA000561.

Interactioni

Subunit structurei

Directly interacts with CYTH2; this interaction stabilizes CCDC120, possibly by preventing ubiquitination.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
CCDC102BA1A4H13EBI-10185348,EBI-10171570
CCDC57Q2TAC23EBI-10185348,EBI-2808286
CEP170P1Q96L143EBI-10185348,EBI-743488
CYTH2Q994183EBI-10185348,EBI-448974
CYTH3O437393EBI-10185348,EBI-741648
EFHC2Q5JST63EBI-10185348,EBI-2349927
KRT31Q153233EBI-10185348,EBI-948001
KRT40Q6A1623EBI-10185348,EBI-10171697
MID2Q9UJV3-23EBI-10185348,EBI-10172526
TRAF1Q130773EBI-10185348,EBI-359224
USHBP1Q8N6Y03EBI-10185348,EBI-739895

Protein-protein interaction databases

BioGridi124658. 68 interactions.
IntActiQ96HB5. 16 interactions.
STRINGi9606.ENSP00000416445.

Structurei

3D structure databases

ProteinModelPortaliQ96HB5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni31 – 7040Involved in CYTH2-binding1 PublicationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili109 – 17365Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi377 – 543167Pro-richAdd
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG119122.
GeneTreeiENSGT00760000119078.
HOGENOMiHOG000231367.
HOVERGENiHBG080242.
InParanoidiQ96HB5.
OMAiGGYSEIL.
OrthoDBiEOG70KGP5.
PhylomeDBiQ96HB5.
TreeFamiTF328984.

Family and domain databases

InterProiIPR021774. DUF3338.
[Graphical view]
PfamiPF11819. DUF3338. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL
60 70 80 90 100
QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA
110 120 130 140 150
HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ
160 170 180 190 200
ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR
210 220 230 240 250
LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR
260 270 280 290 300
AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG
310 320 330 340 350
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL
360 370 380 390 400
FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER
410 420 430 440 450
PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD
460 470 480 490 500
RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL
510 520 530 540 550
LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG
560 570 580 590 600
HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA
610 620 630
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY
Length:630
Mass (Da):67,567
Last modified:December 1, 2001 - v1
Checksum:iE652C8AFD738BF6E
GO
Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.

Note: No experimental confirmation available.
Show »
Length:618
Mass (Da):66,354
Checksum:i3BB9CCCF52CB53F0
GO
Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:661
Mass (Da):70,911
Checksum:i45084D2BED260DC9
GO
Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.
Show »
Length:696
Mass (Da):74,970
Checksum:iB9722ECBDF715B75
GO
Isoform 5 (identifier: Q96HB5-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Show »
Length:649
Mass (Da):69,698
Checksum:i149F30E4292E9782
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4. 1 PublicationVSP_054527
Alternative sequencei5 – 1612Missing in isoform 2 and isoform 5. 1 PublicationVSP_042859Add
BLAST
Alternative sequencei626 – 6305GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3, isoform 4 and isoform 5. 1 PublicationVSP_047104

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ896186 mRNA. No translation available.
AK293898 mRNA. Translation: BAG57285.1.
AK294024 mRNA. Translation: BAG57382.1.
AK291370 mRNA. Translation: BAF84059.1.
AK300366 mRNA. Translation: BAG62104.1.
AK315837 mRNA. Translation: BAF98728.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50708.1.
BC008769 mRNA. Translation: AAH08769.1.
CCDSiCCDS14316.1. [Q96HB5-1]
CCDS55413.1. [Q96HB5-2]
CCDS55414.2. [Q96HB5-4]
RefSeqiNP_001156793.2. NM_001163321.2. [Q96HB5-4]
NP_001156794.1. NM_001163322.2.
NP_001156795.1. NM_001163323.2. [Q96HB5-2]
NP_001258764.1. NM_001271835.1. [Q96HB5-1]
NP_001258765.1. NM_001271836.1. [Q96HB5-1]
NP_296375.1. NM_033626.3. [Q96HB5-1]
UniGeneiHs.522643.

Genome annotation databases

EnsembliENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144. [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144. [Q96HB5-1]
GeneIDi90060.
KEGGihsa:90060.
UCSCiuc004dmf.4. human. [Q96HB5-1]
uc011mmr.3. human.
uc011mms.3. human. [Q96HB5-2]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ896186 mRNA. No translation available.
AK293898 mRNA. Translation: BAG57285.1.
AK294024 mRNA. Translation: BAG57382.1.
AK291370 mRNA. Translation: BAF84059.1.
AK300366 mRNA. Translation: BAG62104.1.
AK315837 mRNA. Translation: BAF98728.1.
AF196779 Genomic DNA. No translation available.
CH471224 Genomic DNA. Translation: EAW50708.1.
BC008769 mRNA. Translation: AAH08769.1.
CCDSiCCDS14316.1. [Q96HB5-1]
CCDS55413.1. [Q96HB5-2]
CCDS55414.2. [Q96HB5-4]
RefSeqiNP_001156793.2. NM_001163321.2. [Q96HB5-4]
NP_001156794.1. NM_001163322.2.
NP_001156795.1. NM_001163323.2. [Q96HB5-2]
NP_001258764.1. NM_001271835.1. [Q96HB5-1]
NP_001258765.1. NM_001271836.1. [Q96HB5-1]
NP_296375.1. NM_033626.3. [Q96HB5-1]
UniGeneiHs.522643.

3D structure databases

ProteinModelPortaliQ96HB5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124658. 68 interactions.
IntActiQ96HB5. 16 interactions.
STRINGi9606.ENSP00000416445.

PTM databases

PhosphoSiteiQ96HB5.

Polymorphism and mutation databases

DMDMi74731908.

Proteomic databases

MaxQBiQ96HB5.
PaxDbiQ96HB5.
PRIDEiQ96HB5.

Protocols and materials databases

DNASUi90060.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144. [Q96HB5-4]
ENST00000606812; ENSP00000475676; ENSG00000147144. [Q96HB5-1]
GeneIDi90060.
KEGGihsa:90060.
UCSCiuc004dmf.4. human. [Q96HB5-1]
uc011mmr.3. human.
uc011mms.3. human. [Q96HB5-2]

Organism-specific databases

CTDi90060.
GeneCardsiGC0XP048916.
HGNCiHGNC:28910. CCDC120.
HPAiHPA000561.
MIMi300947. gene.
neXtProtiNX_Q96HB5.
PharmGKBiPA145149329.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG119122.
GeneTreeiENSGT00760000119078.
HOGENOMiHOG000231367.
HOVERGENiHBG080242.
InParanoidiQ96HB5.
OMAiGGYSEIL.
OrthoDBiEOG70KGP5.
PhylomeDBiQ96HB5.
TreeFamiTF328984.

Miscellaneous databases

ChiTaRSiCCDC120. human.
GenomeRNAii90060.
NextBioi76501.
PROiQ96HB5.
SOURCEiSearch...

Gene expression databases

BgeeiQ96HB5.
CleanExiHS_CCDC120.
ExpressionAtlasiQ96HB5. baseline and differential.
GenevisibleiQ96HB5. HS.

Family and domain databases

InterProiIPR021774. DUF3338.
[Graphical view]
PfamiPF11819. DUF3338. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning of human full-length CDS FLEXGene in Gateway(TM) recombinational vector system."
    Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y., Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.
    Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4 AND 5).
    Tissue: Cerebellum, Fetal brain and Placenta.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Choriocarcinoma.
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  7. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  8. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  9. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Arf6 guanine nucleotide exchange factor cytohesin-2 binds to CCDC120 and is transported along neurites to mediate neurite growth."
    Torii T., Miyamoto Y., Tago K., Sango K., Nakamura K., Sanbe A., Tanoue A., Yamauchi J.
    J. Biol. Chem. 289:33887-33903(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CYTH2, SUBCELLULAR LOCATION, UBIQUITINATION.

Entry informationi

Entry nameiCC120_HUMAN
AccessioniPrimary (citable) accession number: Q96HB5
Secondary accession number(s): A8K5Q5
, B4DF24, B4DFC1, B4DTU2, F5GZU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: June 24, 2015
This is version 94 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.