SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96HB5

- CC120_HUMAN

UniProt

Q96HB5 - CC120_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Coiled-coil domain-containing protein 120
Gene
CCDC120, JM11
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Coiled-coil domain-containing protein 120
Gene namesi
Name:CCDC120
ORF Names:JM11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:28910. CCDC120.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145149329.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 630630Coiled-coil domain-containing protein 120
PRO_0000254141Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei358 – 3581Phosphoserine1 Publication
Modified residuei360 – 3601Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96HB5.
PaxDbiQ96HB5.
PRIDEiQ96HB5.

PTM databases

PhosphoSiteiQ96HB5.

Expressioni

Gene expression databases

ArrayExpressiQ96HB5.
BgeeiQ96HB5.
CleanExiHS_CCDC120.
GenevestigatoriQ96HB5.

Organism-specific databases

HPAiHPA000561.

Interactioni

Protein-protein interaction databases

BioGridi124658. 8 interactions.
IntActiQ96HB5. 8 interactions.
STRINGi9606.ENSP00000365577.

Structurei

3D structure databases

ProteinModelPortaliQ96HB5.

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili109 – 17365 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi377 – 543167Pro-rich
Add
BLAST

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG119122.
HOGENOMiHOG000231367.
HOVERGENiHBG080242.
InParanoidiQ96HB5.
OMAiINGHTEL.
OrthoDBiEOG70KGP5.
PhylomeDBiQ96HB5.
TreeFamiTF328984.

Family and domain databases

InterProiIPR021774. DUF3338.
[Graphical view]
PfamiPF11819. DUF3338. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96HB5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEVKGQLISS PTFNAPAALF GEAAPQVKSE RLRGLLDRQR TLQEALSLKL    50
QELRKVCLQE AELTGQLPPE CPLEPGERPQ LVRRRPPTAR AYPPPHPNQA 100
HHSLCPAEEL ALEALEREVS VQQQIAAAAR RLALAPDLST EQRRRRRQVQ 150
ADALRRLHEL EEQLRDVRAR LGLPVLPLPQ PLPLSTGSVI TTQGVCLGMR 200
LAQLSQEDVV LHSESSSLSE SGASHDNEEP HGCFSLAERP SPPKAWDQLR 250
AVSGGSPERR TPWKPPPSDL YGDLKSRRNS VASPTSPTRS LPRSASSFEG 300
RSVPATPVLT RGAGPQLCKP EGLHSRQWSG SQDSQMGFPR ADPASDRASL 350
FVARTRRSNS SEALLVDRAA GGGAGSPPAP LAPSASGPPV CKSSEVLYER 400
PQPTPAFSSR TAGPPDPPRA ARPSSAAPAS RGAPRLPPVC GDFLLDYSLD 450
RGLPRSGGGT GWGELPPAAE VPGPLSRRDG LLTMLPGPPP VYAADSNSPL 500
LRTKDPHTRA TRTKPCGLPP EAAEGPEVHP NPLLWMPPPT RIPSAGERSG 550
HKNLALEGLR DWYIRNSGLA AGPQRRPVLP SVGPPHPPFL HARCYEVGQA 600
LYGAPSQAPL PHSRSFTAPP VSGRYGGCFY 630
Length:630
Mass (Da):67,567
Last modified:December 1, 2001 - v1
Checksum:iE652C8AFD738BF6E
GO
Isoform 2 (identifier: Q96HB5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     5-16: Missing.

Note: No experimental confirmation available.

Show »
Length:618
Mass (Da):66,354
Checksum:i3BB9CCCF52CB53F0
GO
Isoform 3 (identifier: Q96HB5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.

Show »
Length:661
Mass (Da):70,911
Checksum:i45084D2BED260DC9
GO
Isoform 4 (identifier: Q96HB5-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRREPRYQGQVGPDIHTDSERTLSSHQPRPLDSTKM
     626-630: GGCFY → YADFLYPPELSARLSDLTLEGEQSSSSDTQTPGTLV

Note: No experimental confirmation available.

Show »
Length:696
Mass (Da):74,970
Checksum:iB9722ECBDF715B75
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MRREPRYQGQVGPDIHTDSE RTLSSHQPRPLDSTKM in isoform 4.
VSP_054527
Alternative sequencei5 – 1612Missing in isoform 2.
VSP_042859Add
BLAST
Alternative sequencei626 – 6305GGCFY → YADFLYPPELSARLSDLTLE GEQSSSSDTQTPGTLV in isoform 3 and isoform 4.
VSP_047104

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ896186 mRNA. No translation available.
AK294024 mRNA. Translation: BAG57382.1.
AK300366 mRNA. Translation: BAG62104.1.
AF196779 Genomic DNA. No translation available.
BC008769 mRNA. Translation: AAH08769.1.
CCDSiCCDS14316.1. [Q96HB5-1]
CCDS55413.1. [Q96HB5-2]
CCDS55414.2. [Q96HB5-4]
RefSeqiNP_001156793.2. NM_001163321.2. [Q96HB5-4]
NP_001156794.1. NM_001163322.2.
NP_001156795.1. NM_001163323.2. [Q96HB5-2]
NP_001258764.1. NM_001271835.1. [Q96HB5-1]
NP_001258765.1. NM_001271836.1. [Q96HB5-1]
NP_296375.1. NM_033626.3. [Q96HB5-1]
UniGeneiHs.522643.

Genome annotation databases

EnsembliENST00000376396; ENSP00000365577; ENSG00000147144. [Q96HB5-1]
ENST00000422185; ENSP00000416445; ENSG00000147144. [Q96HB5-3]
ENST00000496529; ENSP00000474761; ENSG00000147144. [Q96HB5-1]
ENST00000536628; ENSP00000443351; ENSG00000147144. [Q96HB5-2]
ENST00000597275; ENSP00000470294; ENSG00000147144. [Q96HB5-1]
ENST00000603986; ENSP00000474071; ENSG00000147144.
GeneIDi90060.
KEGGihsa:90060.
UCSCiuc004dmf.4. human. [Q96HB5-1]
uc011mms.3. human. [Q96HB5-2]

Polymorphism databases

DMDMi74731908.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
DQ896186 mRNA. No translation available.
AK294024 mRNA. Translation: BAG57382.1 .
AK300366 mRNA. Translation: BAG62104.1 .
AF196779 Genomic DNA. No translation available.
BC008769 mRNA. Translation: AAH08769.1 .
CCDSi CCDS14316.1. [Q96HB5-1 ]
CCDS55413.1. [Q96HB5-2 ]
CCDS55414.2. [Q96HB5-4 ]
RefSeqi NP_001156793.2. NM_001163321.2. [Q96HB5-4 ]
NP_001156794.1. NM_001163322.2.
NP_001156795.1. NM_001163323.2. [Q96HB5-2 ]
NP_001258764.1. NM_001271835.1. [Q96HB5-1 ]
NP_001258765.1. NM_001271836.1. [Q96HB5-1 ]
NP_296375.1. NM_033626.3. [Q96HB5-1 ]
UniGenei Hs.522643.

3D structure databases

ProteinModelPortali Q96HB5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124658. 8 interactions.
IntActi Q96HB5. 8 interactions.
STRINGi 9606.ENSP00000365577.

PTM databases

PhosphoSitei Q96HB5.

Polymorphism databases

DMDMi 74731908.

Proteomic databases

MaxQBi Q96HB5.
PaxDbi Q96HB5.
PRIDEi Q96HB5.

Protocols and materials databases

DNASUi 90060.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000376396 ; ENSP00000365577 ; ENSG00000147144 . [Q96HB5-1 ]
ENST00000422185 ; ENSP00000416445 ; ENSG00000147144 . [Q96HB5-3 ]
ENST00000496529 ; ENSP00000474761 ; ENSG00000147144 . [Q96HB5-1 ]
ENST00000536628 ; ENSP00000443351 ; ENSG00000147144 . [Q96HB5-2 ]
ENST00000597275 ; ENSP00000470294 ; ENSG00000147144 . [Q96HB5-1 ]
ENST00000603986 ; ENSP00000474071 ; ENSG00000147144 .
GeneIDi 90060.
KEGGi hsa:90060.
UCSCi uc004dmf.4. human. [Q96HB5-1 ]
uc011mms.3. human. [Q96HB5-2 ]

Organism-specific databases

CTDi 90060.
GeneCardsi GC0XP048916.
HGNCi HGNC:28910. CCDC120.
HPAi HPA000561.
neXtProti NX_Q96HB5.
PharmGKBi PA145149329.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG119122.
HOGENOMi HOG000231367.
HOVERGENi HBG080242.
InParanoidi Q96HB5.
OMAi INGHTEL.
OrthoDBi EOG70KGP5.
PhylomeDBi Q96HB5.
TreeFami TF328984.

Miscellaneous databases

ChiTaRSi CCDC120. human.
GenomeRNAii 90060.
NextBioi 76501.
PROi Q96HB5.

Gene expression databases

ArrayExpressi Q96HB5.
Bgeei Q96HB5.
CleanExi HS_CCDC120.
Genevestigatori Q96HB5.

Family and domain databases

InterProi IPR021774. DUF3338.
[Graphical view ]
Pfami PF11819. DUF3338. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Cloning of human full-length CDS FLEXGene in Gateway(TM) recombinational vector system."
    Rolfs A., Kelley F., McCarron S., Jepson D., Shen B., Shi Z., Hu Y., Taycher E., Zuo D., Ebert L., Hoerlein A., Ernst U., Korn B., LaBaer J.
    Submitted (SEP-2006) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Cerebellum and Placenta.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Choriocarcinoma.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Embryonic kidney.
  6. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-358, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-360, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  8. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiCC120_HUMAN
AccessioniPrimary (citable) accession number: Q96HB5
Secondary accession number(s): B4DFC1, B4DTU2, F5GZU4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 85 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM

External Data

Dasty 3

Similar proteinsi