Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C1orf159

Gene

C1orf159

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131591-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C1orf159
Gene namesi
ORF Names:UNQ2998/PRO9739
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:26062. C1orf159.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei148 – 168HelicalSequence analysisAdd BLAST21

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000131591.
PharmGKBiPA142672410.

Polymorphism and mutation databases

DMDMi119371554.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 18Sequence analysisAdd BLAST18
ChainiPRO_000025525019 – 380Uncharacterized protein C1orf159Add BLAST362

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi104N-linked (GlcNAc...)Sequence analysis1
Glycosylationi111N-linked (GlcNAc...)Sequence analysis1
Glycosylationi128N-linked (GlcNAc...)Sequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ96HA4.
MaxQBiQ96HA4.
PaxDbiQ96HA4.
PeptideAtlasiQ96HA4.
PRIDEiQ96HA4.

PTM databases

iPTMnetiQ96HA4.
PhosphoSitePlusiQ96HA4.

Expressioni

Gene expression databases

BgeeiENSG00000131591.
CleanExiHS_C1orf159.
ExpressionAtlasiQ96HA4. baseline and differential.
GenevisibleiQ96HA4. HS.

Organism-specific databases

HPAiHPA010019.

Interactioni

Protein-protein interaction databases

BioGridi120325. 3 interactors.
STRINGi9606.ENSP00000368623.

Structurei

3D structure databases

ProteinModelPortaliQ96HA4.
SMRiQ96HA4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi229 – 291Pro-richAdd BLAST63

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IY0B. Eukaryota.
ENOG4111QE9. LUCA.
GeneTreeiENSGT00390000009794.
HOGENOMiHOG000231900.
HOVERGENiHBG058261.
InParanoidiQ96HA4.
OMAiWGLQERR.
OrthoDBiEOG091G17WA.
PhylomeDBiQ96HA4.
TreeFamiTF330740.

Family and domain databases

InterProiIPR027888. DUF4501.
[Graphical view]
PfamiPF14946. DUF4501. 2 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96HA4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALRHLALLA GLLVGVASKS MENTVTRNST AVINTQAEGT LSPPGLSSLP
60 70 80 90 100
VVREWALTHT AQLPECCVDV VGVNASCPGA SLCGPGCYRR WNADGSASCV
110 120 130 140 150
RCGNGTLPAY NGSECRSFAG PGAPFPMNRS SGTPGRPHPG APRVAASLFL
160 170 180 190 200
GTFFISSGLI LSVAGFFYLK RSSKLPRACY RRNKAPALQP GEAAAMIPPP
210 220 230 240 250
QSSGNSSCRI PLWGFPSLGQ SQGALWVCPQ TGLPGSGSRP PLPGSPGDPP
260 270 280 290 300
TRQGQGRIWL VPPALDLSWI WPAPPARPPL IPVTSMLFPV PETWGLQERR
310 320 330 340 350
THHDRADPQY LLLLEVQLHP RTDAAGLRQA LLSSHRFSGA GSGGPKSQPV
360 370 380
RKPRYVRRER PLDRATDPAA FPGEARISNV
Note: Gene prediction based on EST data.
Length:380
Mass (Da):40,283
Last modified:October 31, 2006 - v2
Checksum:iD82F85CF3D903B81
GO
Isoform 2 (identifier: Q96HA4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     185-221: APALQPGEAAAMIPPPQSSGNSSCRIPLWGFPSLGQS → GPAPAGSLPGRWSSQQFGPQAPALQPGEAVSNPHHPG
     222-380: Missing.

Note: No experimental confirmation available.
Show »
Length:185
Mass (Da):19,097
Checksum:i2488F40B8F1239C3
GO
Isoform 3 (identifier: Q96HA4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-225: GNSSCRIPLWGFPSLGQSQGAL → DVGSAGKEDPPRQGRPPIPAPP
     226-380: Missing.

Note: No experimental confirmation available.
Show »
Length:189
Mass (Da):19,464
Checksum:iB442CB2A09470157
GO
Isoform 4 (identifier: Q96HA4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     25-60: Missing.
     204-349: Missing.

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):20,820
Checksum:i734467FBB65598A9
GO
Isoform 5 (identifier: Q96HA4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-126: Missing.

Note: No experimental confirmation available.
Show »
Length:254
Mass (Da):27,411
Checksum:i76175CE950FF64C1
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212801 – 126Missing in isoform 5. 1 PublicationAdd BLAST126
Alternative sequenceiVSP_02128125 – 60Missing in isoform 2, isoform 3 and isoform 4. 3 PublicationsAdd BLAST36
Alternative sequenceiVSP_021282185 – 221APALQ…SLGQS → GPAPAGSLPGRWSSQQFGPQ APALQPGEAVSNPHHPG in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_021283204 – 349Missing in isoform 4. 1 PublicationAdd BLAST146
Alternative sequenceiVSP_021284204 – 225GNSSC…SQGAL → DVGSAGKEDPPRQGRPPIPA PP in isoform 3. 1 PublicationAdd BLAST22
Alternative sequenceiVSP_021285222 – 380Missing in isoform 2. 1 PublicationAdd BLAST159
Alternative sequenceiVSP_021286226 – 380Missing in isoform 3. 1 PublicationAdd BLAST155

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358490 mRNA. Translation: AAQ88854.1.
AK000591 mRNA. Translation: BAA91276.1.
AK057368 mRNA. Translation: BAG51908.1.
AK128434 mRNA. Translation: BAC87438.1.
AL390719 Genomic DNA. Translation: CAI14316.1.
AL390719 Genomic DNA. Translation: CAI14318.1.
BC008788 mRNA. Translation: AAH08788.1.
CCDSiCCDS7.2. [Q96HA4-4]
CCDS81250.1. [Q96HA4-1]
RefSeqiNP_001317235.1. NM_001330306.1.
NP_060361.4. NM_017891.4. [Q96HA4-4]
XP_011539963.1. XM_011541661.2. [Q96HA4-1]
XP_011539964.1. XM_011541662.2. [Q96HA4-1]
XP_016857065.1. XM_017001576.1. [Q96HA4-1]
UniGeneiHs.235095.

Genome annotation databases

EnsembliENST00000379319; ENSP00000368623; ENSG00000131591. [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591. [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591. [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591. [Q96HA4-4]
GeneIDi54991.
KEGGihsa:54991.
UCSCiuc001act.3. human. [Q96HA4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358490 mRNA. Translation: AAQ88854.1.
AK000591 mRNA. Translation: BAA91276.1.
AK057368 mRNA. Translation: BAG51908.1.
AK128434 mRNA. Translation: BAC87438.1.
AL390719 Genomic DNA. Translation: CAI14316.1.
AL390719 Genomic DNA. Translation: CAI14318.1.
BC008788 mRNA. Translation: AAH08788.1.
CCDSiCCDS7.2. [Q96HA4-4]
CCDS81250.1. [Q96HA4-1]
RefSeqiNP_001317235.1. NM_001330306.1.
NP_060361.4. NM_017891.4. [Q96HA4-4]
XP_011539963.1. XM_011541661.2. [Q96HA4-1]
XP_011539964.1. XM_011541662.2. [Q96HA4-1]
XP_016857065.1. XM_017001576.1. [Q96HA4-1]
UniGeneiHs.235095.

3D structure databases

ProteinModelPortaliQ96HA4.
SMRiQ96HA4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120325. 3 interactors.
STRINGi9606.ENSP00000368623.

PTM databases

iPTMnetiQ96HA4.
PhosphoSitePlusiQ96HA4.

Polymorphism and mutation databases

DMDMi119371554.

Proteomic databases

EPDiQ96HA4.
MaxQBiQ96HA4.
PaxDbiQ96HA4.
PeptideAtlasiQ96HA4.
PRIDEiQ96HA4.

Protocols and materials databases

DNASUi54991.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000379319; ENSP00000368623; ENSG00000131591. [Q96HA4-4]
ENST00000379325; ENSP00000368629; ENSG00000131591. [Q96HA4-3]
ENST00000379339; ENSP00000368644; ENSG00000131591. [Q96HA4-1]
ENST00000421241; ENSP00000400736; ENSG00000131591. [Q96HA4-4]
GeneIDi54991.
KEGGihsa:54991.
UCSCiuc001act.3. human. [Q96HA4-1]

Organism-specific databases

CTDi54991.
GeneCardsiC1orf159.
H-InvDBHIX0000013.
HGNCiHGNC:26062. C1orf159.
HPAiHPA010019.
neXtProtiNX_Q96HA4.
OpenTargetsiENSG00000131591.
PharmGKBiPA142672410.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IY0B. Eukaryota.
ENOG4111QE9. LUCA.
GeneTreeiENSGT00390000009794.
HOGENOMiHOG000231900.
HOVERGENiHBG058261.
InParanoidiQ96HA4.
OMAiWGLQERR.
OrthoDBiEOG091G17WA.
PhylomeDBiQ96HA4.
TreeFamiTF330740.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000131591-MONOMER.

Miscellaneous databases

ChiTaRSiC1orf159. human.
GenomeRNAii54991.
PROiQ96HA4.

Gene expression databases

BgeeiENSG00000131591.
CleanExiHS_C1orf159.
ExpressionAtlasiQ96HA4. baseline and differential.
GenevisibleiQ96HA4. HS.

Family and domain databases

InterProiIPR027888. DUF4501.
[Graphical view]
PfamiPF14946. DUF4501. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCA159_HUMAN
AccessioniPrimary (citable) accession number: Q96HA4
Secondary accession number(s): B3KQ46
, Q5T2W6, Q6UX67, Q6ZR77, Q9NWV0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: October 31, 2006
Last modified: November 30, 2016
This is version 103 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.