Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centromere protein N

Gene

CENPN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.4 Publications

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein N
Short name:
CENP-N
Alternative name(s):
Interphase centromere complex protein 32
Gene namesi
Name:CENPN
Synonyms:C16orf60, ICEN32
ORF Names:BM-309
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:30873. CENPN.

Subcellular locationi

  • Nucleus
  • Chromosomecentromerekinetochore

  • Note: Localizes exclusively in the kinetochore domain of centromeres. Kinetochore-bound levels decrease when cells enter mitosis and increase again when cells exit mitosis.

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi11R → A: Decreases the binding to centromeres. 1 Publication1
Mutagenesisi196R → A: Decreases the binding to centromeres. 1 Publication1

Organism-specific databases

DisGeNETi55839.
OpenTargetsiENSG00000166451.
PharmGKBiPA143485397.

Polymorphism and mutation databases

BioMutaiCENPN.
DMDMi308153423.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002494941 – 339Centromere protein NAdd BLAST339

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei226PhosphoserineCombined sources1
Modified residuei235PhosphoserineCombined sources1
Modified residuei282PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96H22.
PaxDbiQ96H22.
PeptideAtlasiQ96H22.
PRIDEiQ96H22.

PTM databases

iPTMnetiQ96H22.
PhosphoSitePlusiQ96H22.

Expressioni

Gene expression databases

BgeeiENSG00000166451.
CleanExiHS_CENPN.
ExpressionAtlasiQ96H22. baseline and differential.
GenevisibleiQ96H22. HS.

Organism-specific databases

HPAiCAB024864.

Interactioni

Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU (PubMed:16622420, PubMed:16622419). The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA (PubMed:19543270). Identified in a centromere complex containing histones H2A, H2B and H4, and at least CENPA, CENPB, CENPC, CENPT, CENPN, HJURP, SUPT16H, SSRP1 and RSF1 (PubMed:27499292).4 Publications

Protein-protein interaction databases

BioGridi120942. 25 interactors.
IntActiQ96H22. 6 interactors.
MINTiMINT-4995499.
STRINGi9606.ENSP00000377007.

Structurei

3D structure databases

ProteinModelPortaliQ96H22.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IKJC. Eukaryota.
ENOG4111H2Z. LUCA.
GeneTreeiENSGT00390000004738.
HOGENOMiHOG000015409.
HOVERGENiHBG058868.
InParanoidiQ96H22.
KOiK11506.
OMAiLTVASKH.
OrthoDBiEOG091G0YMK.
PhylomeDBiQ96H22.
TreeFamiTF329714.

Family and domain databases

InterProiIPR027715. CENP-N.
IPR007902. Chl4/mis15/CENP-N.
[Graphical view]
PANTHERiPTHR12309:SF12. PTHR12309:SF12. 1 hit.
PfamiPF05238. CENP-N. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96H22-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDETVAEFIK RTILKIPMNE LTTILKAWDF LSENQLQTVN FRQRKESVVQ
60 70 80 90 100
HLIHLCEEKR ASISDAALLD IIYMQFHQHQ KVWEVFQMSK GPGEDVDLFD
110 120 130 140 150
MKQFKNSFKK ILQRALKNVT VSFRETEENA VWIRIAWGTQ YTKPNQYKPT
160 170 180 190 200
YVVYYSQTPY AFTSSSMLRR NTPLLGQALT IASKHHQIVK MDLRSRYLDS
210 220 230 240 250
LKAIVFKQYN QTFETHNSTT PLQERSLGLD INMDSRIIHE NIVEKERVQR
260 270 280 290 300
ITQETFGDYP QPQLEFAQYK LETKFKSGLN GSILAEREEP LRCLIKFSSP
310 320 330
HLLEALKSLA PAGIADAPLS PLLTCIPNKR MNYFKIRDK
Length:339
Mass (Da):39,555
Last modified:October 5, 2010 - v2
Checksum:i7A0D3326032DE99B
GO
Isoform 2 (identifier: Q96H22-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN
     205-339: Missing.

Show »
Length:204
Mass (Da):24,067
Checksum:i3954E4F78E020360
GO
Isoform 3 (identifier: Q96H22-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC

Note: No experimental confirmation available.
Show »
Length:353
Mass (Da):41,194
Checksum:iB3366A33C89CD296
GO
Isoform 4 (identifier: Q96H22-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-93: YMQFHQHQKVWEVFQMSKGPG → C

Note: No experimental confirmation available.
Show »
Length:319
Mass (Da):37,083
Checksum:i52873DA13A654ED2
GO
Isoform 5 (identifier: Q96H22-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-210: Missing.

Note: No experimental confirmation available.
Show »
Length:305
Mass (Da):35,556
Checksum:i5D7E6CFAB91045CD
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti139T → A in AK026313 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02741984E → D.4 PublicationsCorresponds to variant rs935939dbSNPEnsembl.1
Natural variantiVAR_048689223Q → R.Corresponds to variant rs11641523dbSNPEnsembl.1
Natural variantiVAR_048690288E → K.1 PublicationCorresponds to variant rs2549887dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04468973 – 93YMQFH…SKGPG → C in isoform 4. 1 PublicationAdd BLAST21
Alternative sequenceiVSP_044690177 – 210Missing in isoform 5. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_020441178 – 204ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. 2 PublicationsAdd BLAST27
Alternative sequenceiVSP_020442205 – 339Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_044565313 – 339GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. 1 PublicationAdd BLAST27

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217515 mRNA. Translation: AAF67626.1.
AK023669 mRNA. Translation: BAG51215.1.
AK026313 mRNA. No translation available.
AK298554 mRNA. Translation: BAG60749.1.
AK296024 mRNA. Translation: BAG58793.1.
AC092718 Genomic DNA. No translation available.
CH471114 Genomic DNA. Translation: EAW95553.1.
CH471114 Genomic DNA. Translation: EAW95556.1.
BC007334 mRNA. Translation: AAH07334.1.
BC008972 mRNA. Translation: AAH08972.1.
CCDSiCCDS10931.1. [Q96H22-2]
CCDS42199.1. [Q96H22-3]
CCDS42200.1. [Q96H22-1]
CCDS58482.1. [Q96H22-5]
CCDS58483.1. [Q96H22-4]
RefSeqiNP_001094094.2. NM_001100624.2. [Q96H22-1]
NP_001094095.2. NM_001100625.2. [Q96H22-3]
NP_001257402.1. NM_001270473.1. [Q96H22-4]
NP_001257403.1. NM_001270474.1. [Q96H22-5]
NP_060925.2. NM_018455.5. [Q96H22-2]
XP_006721299.1. XM_006721236.3. [Q96H22-1]
XP_016878945.1. XM_017023456.1. [Q96H22-2]
UniGeneiHs.726537.

Genome annotation databases

EnsembliENST00000299572; ENSP00000299572; ENSG00000166451. [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451. [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451. [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451. [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451. [Q96H22-4]
GeneIDi55839.
KEGGihsa:55839.
UCSCiuc002ffw.5. human. [Q96H22-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF217515 mRNA. Translation: AAF67626.1.
AK023669 mRNA. Translation: BAG51215.1.
AK026313 mRNA. No translation available.
AK298554 mRNA. Translation: BAG60749.1.
AK296024 mRNA. Translation: BAG58793.1.
AC092718 Genomic DNA. No translation available.
CH471114 Genomic DNA. Translation: EAW95553.1.
CH471114 Genomic DNA. Translation: EAW95556.1.
BC007334 mRNA. Translation: AAH07334.1.
BC008972 mRNA. Translation: AAH08972.1.
CCDSiCCDS10931.1. [Q96H22-2]
CCDS42199.1. [Q96H22-3]
CCDS42200.1. [Q96H22-1]
CCDS58482.1. [Q96H22-5]
CCDS58483.1. [Q96H22-4]
RefSeqiNP_001094094.2. NM_001100624.2. [Q96H22-1]
NP_001094095.2. NM_001100625.2. [Q96H22-3]
NP_001257402.1. NM_001270473.1. [Q96H22-4]
NP_001257403.1. NM_001270474.1. [Q96H22-5]
NP_060925.2. NM_018455.5. [Q96H22-2]
XP_006721299.1. XM_006721236.3. [Q96H22-1]
XP_016878945.1. XM_017023456.1. [Q96H22-2]
UniGeneiHs.726537.

3D structure databases

ProteinModelPortaliQ96H22.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120942. 25 interactors.
IntActiQ96H22. 6 interactors.
MINTiMINT-4995499.
STRINGi9606.ENSP00000377007.

PTM databases

iPTMnetiQ96H22.
PhosphoSitePlusiQ96H22.

Polymorphism and mutation databases

BioMutaiCENPN.
DMDMi308153423.

Proteomic databases

MaxQBiQ96H22.
PaxDbiQ96H22.
PeptideAtlasiQ96H22.
PRIDEiQ96H22.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000299572; ENSP00000299572; ENSG00000166451. [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451. [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451. [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451. [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451. [Q96H22-4]
GeneIDi55839.
KEGGihsa:55839.
UCSCiuc002ffw.5. human. [Q96H22-1]

Organism-specific databases

CTDi55839.
DisGeNETi55839.
GeneCardsiCENPN.
HGNCiHGNC:30873. CENPN.
HPAiCAB024864.
MIMi611509. gene.
neXtProtiNX_Q96H22.
OpenTargetsiENSG00000166451.
PharmGKBiPA143485397.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IKJC. Eukaryota.
ENOG4111H2Z. LUCA.
GeneTreeiENSGT00390000004738.
HOGENOMiHOG000015409.
HOVERGENiHBG058868.
InParanoidiQ96H22.
KOiK11506.
OMAiLTVASKH.
OrthoDBiEOG091G0YMK.
PhylomeDBiQ96H22.
TreeFamiTF329714.

Enzyme and pathway databases

ReactomeiR-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-68877. Mitotic Prometaphase.

Miscellaneous databases

GeneWikiiCENPN.
GenomeRNAii55839.
PROiQ96H22.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000166451.
CleanExiHS_CENPN.
ExpressionAtlasiQ96H22. baseline and differential.
GenevisibleiQ96H22. HS.

Family and domain databases

InterProiIPR027715. CENP-N.
IPR007902. Chl4/mis15/CENP-N.
[Graphical view]
PANTHERiPTHR12309:SF12. PTHR12309:SF12. 1 hit.
PfamiPF05238. CENP-N. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCENPN_HUMAN
AccessioniPrimary (citable) accession number: Q96H22
Secondary accession number(s): A8MZE6
, B3KN53, B4DJD1, B4DPY7, C9JJM5, D3DUK8, E7ES30, E7ETS3, Q9NZ83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: October 5, 2010
Last modified: November 2, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.