Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96H22

- CENPN_HUMAN

UniProt

Q96H22 - CENPN_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Centromere protein N

Gene

CENPN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.4 Publications

GO - Biological processi

  1. CENP-A containing nucleosome assembly Source: Reactome
  2. chromosome segregation Source: InterPro
  3. mitotic cell cycle Source: Reactome
  4. mitotic nuclear division Source: InterPro
  5. nucleosome assembly Source: Reactome
Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_22186. Deposition of new CENPA-containing nucleosomes at the centromere.
REACT_682. Mitotic Prometaphase.

Names & Taxonomyi

Protein namesi
Recommended name:
Centromere protein N
Short name:
CENP-N
Alternative name(s):
Interphase centromere complex protein 32
Gene namesi
Name:CENPN
Synonyms:C16orf60, ICEN32
ORF Names:BM-309
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:30873. CENPN.

Subcellular locationi

Nucleus. Chromosomecentromerekinetochore
Note: Localizes exclusively in the kinetochore domain of centromeres. Kinetochore-bound levels decrease when cells enter mitosis and increase again when cells exit mitosis.

GO - Cellular componenti

  1. cytosol Source: Reactome
  2. kinetochore Source: UniProtKB-KW
  3. nucleoplasm Source: Reactome
  4. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Kinetochore, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi11 – 111R → A: Decreases the binding to centromeres. 1 Publication
Mutagenesisi196 – 1961R → A: Decreases the binding to centromeres. 1 Publication

Organism-specific databases

PharmGKBiPA143485397.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 339339Centromere protein NPRO_0000249494Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei226 – 2261Phosphoserine5 Publications
Modified residuei282 – 2821Phosphoserine4 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96H22.
PaxDbiQ96H22.
PRIDEiQ96H22.

PTM databases

PhosphoSiteiQ96H22.

Expressioni

Gene expression databases

BgeeiQ96H22.
CleanExiHS_CENPN.
ExpressionAtlasiQ96H22. baseline and differential.
GenevestigatoriQ96H22.

Organism-specific databases

HPAiHPA052870.

Interactioni

Subunit structurei

Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA.3 Publications

Protein-protein interaction databases

BioGridi120942. 14 interactions.
IntActiQ96H22. 1 interaction.
MINTiMINT-4995499.
STRINGi9606.ENSP00000377007.

Family & Domainsi

Phylogenomic databases

eggNOGiNOG17730.
GeneTreeiENSGT00390000004738.
HOGENOMiHOG000015409.
HOVERGENiHBG058868.
InParanoidiQ96H22.
KOiK11506.
OMAiHEDMEEA.
OrthoDBiEOG7P8PB4.
PhylomeDBiQ96H22.
TreeFamiTF329714.

Family and domain databases

InterProiIPR027715. CENP-N.
IPR007902. Chl4/mis15/CENP-N.
[Graphical view]
PANTHERiPTHR32250. PTHR32250. 1 hit.
PfamiPF05238. CENP-N. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96H22-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDETVAEFIK RTILKIPMNE LTTILKAWDF LSENQLQTVN FRQRKESVVQ
60 70 80 90 100
HLIHLCEEKR ASISDAALLD IIYMQFHQHQ KVWEVFQMSK GPGEDVDLFD
110 120 130 140 150
MKQFKNSFKK ILQRALKNVT VSFRETEENA VWIRIAWGTQ YTKPNQYKPT
160 170 180 190 200
YVVYYSQTPY AFTSSSMLRR NTPLLGQALT IASKHHQIVK MDLRSRYLDS
210 220 230 240 250
LKAIVFKQYN QTFETHNSTT PLQERSLGLD INMDSRIIHE NIVEKERVQR
260 270 280 290 300
ITQETFGDYP QPQLEFAQYK LETKFKSGLN GSILAEREEP LRCLIKFSSP
310 320 330
HLLEALKSLA PAGIADAPLS PLLTCIPNKR MNYFKIRDK
Length:339
Mass (Da):39,555
Last modified:October 5, 2010 - v2
Checksum:i7A0D3326032DE99B
GO
Isoform 2 (identifier: Q96H22-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN
     205-339: Missing.

Show »
Length:204
Mass (Da):24,067
Checksum:i3954E4F78E020360
GO
Isoform 3 (identifier: Q96H22-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC

Note: No experimental confirmation available.

Show »
Length:353
Mass (Da):41,194
Checksum:iB3366A33C89CD296
GO
Isoform 4 (identifier: Q96H22-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-93: YMQFHQHQKVWEVFQMSKGPG → C

Note: No experimental confirmation available.

Show »
Length:319
Mass (Da):37,083
Checksum:i52873DA13A654ED2
GO
Isoform 5 (identifier: Q96H22-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-210: Missing.

Note: No experimental confirmation available.

Show »
Length:305
Mass (Da):35,556
Checksum:i5D7E6CFAB91045CD
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti139 – 1391T → A in AK026313. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti84 – 841E → D.4 Publications
Corresponds to variant rs935939 [ dbSNP | Ensembl ].
VAR_027419
Natural varianti223 – 2231Q → R.
Corresponds to variant rs11641523 [ dbSNP | Ensembl ].
VAR_048689
Natural varianti288 – 2881E → K.1 Publication
Corresponds to variant rs2549887 [ dbSNP | Ensembl ].
VAR_048690

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei73 – 9321YMQFH…SKGPG → C in isoform 4. 1 PublicationVSP_044689Add
BLAST
Alternative sequencei177 – 21034Missing in isoform 5. 1 PublicationVSP_044690Add
BLAST
Alternative sequencei178 – 20427ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. 2 PublicationsVSP_020441Add
BLAST
Alternative sequencei205 – 339135Missing in isoform 2. 2 PublicationsVSP_020442Add
BLAST
Alternative sequencei313 – 33927GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. 1 PublicationVSP_044565Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF217515 mRNA. Translation: AAF67626.1.
AK023669 mRNA. Translation: BAG51215.1.
AK026313 mRNA. No translation available.
AK298554 mRNA. Translation: BAG60749.1.
AK296024 mRNA. Translation: BAG58793.1.
AC092718 Genomic DNA. No translation available.
CH471114 Genomic DNA. Translation: EAW95553.1.
CH471114 Genomic DNA. Translation: EAW95556.1.
BC007334 mRNA. Translation: AAH07334.1.
BC008972 mRNA. Translation: AAH08972.1.
CCDSiCCDS10931.1. [Q96H22-2]
CCDS42199.1. [Q96H22-3]
CCDS42200.1. [Q96H22-1]
CCDS58482.1. [Q96H22-5]
CCDS58483.1. [Q96H22-4]
RefSeqiNP_001094094.2. NM_001100624.2. [Q96H22-1]
NP_001094095.2. NM_001100625.2. [Q96H22-3]
NP_001257402.1. NM_001270473.1. [Q96H22-4]
NP_001257403.1. NM_001270474.1. [Q96H22-5]
NP_060925.2. NM_018455.5. [Q96H22-2]
XP_006721299.1. XM_006721236.1. [Q96H22-1]
UniGeneiHs.726537.

Genome annotation databases

EnsembliENST00000299572; ENSP00000299572; ENSG00000166451. [Q96H22-2]
ENST00000305850; ENSP00000305608; ENSG00000166451. [Q96H22-1]
ENST00000393335; ENSP00000377007; ENSG00000166451. [Q96H22-3]
ENST00000428963; ENSP00000393991; ENSG00000166451. [Q96H22-5]
ENST00000439957; ENSP00000395235; ENSG00000166451. [Q96H22-4]
GeneIDi55839.
KEGGihsa:55839.
UCSCiuc002ffw.4. human. [Q96H22-2]
uc002ffx.2. human. [Q96H22-1]

Polymorphism databases

DMDMi308153423.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF217515 mRNA. Translation: AAF67626.1 .
AK023669 mRNA. Translation: BAG51215.1 .
AK026313 mRNA. No translation available.
AK298554 mRNA. Translation: BAG60749.1 .
AK296024 mRNA. Translation: BAG58793.1 .
AC092718 Genomic DNA. No translation available.
CH471114 Genomic DNA. Translation: EAW95553.1 .
CH471114 Genomic DNA. Translation: EAW95556.1 .
BC007334 mRNA. Translation: AAH07334.1 .
BC008972 mRNA. Translation: AAH08972.1 .
CCDSi CCDS10931.1. [Q96H22-2 ]
CCDS42199.1. [Q96H22-3 ]
CCDS42200.1. [Q96H22-1 ]
CCDS58482.1. [Q96H22-5 ]
CCDS58483.1. [Q96H22-4 ]
RefSeqi NP_001094094.2. NM_001100624.2. [Q96H22-1 ]
NP_001094095.2. NM_001100625.2. [Q96H22-3 ]
NP_001257402.1. NM_001270473.1. [Q96H22-4 ]
NP_001257403.1. NM_001270474.1. [Q96H22-5 ]
NP_060925.2. NM_018455.5. [Q96H22-2 ]
XP_006721299.1. XM_006721236.1. [Q96H22-1 ]
UniGenei Hs.726537.

3D structure databases

ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120942. 14 interactions.
IntActi Q96H22. 1 interaction.
MINTi MINT-4995499.
STRINGi 9606.ENSP00000377007.

PTM databases

PhosphoSitei Q96H22.

Polymorphism databases

DMDMi 308153423.

Proteomic databases

MaxQBi Q96H22.
PaxDbi Q96H22.
PRIDEi Q96H22.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000299572 ; ENSP00000299572 ; ENSG00000166451 . [Q96H22-2 ]
ENST00000305850 ; ENSP00000305608 ; ENSG00000166451 . [Q96H22-1 ]
ENST00000393335 ; ENSP00000377007 ; ENSG00000166451 . [Q96H22-3 ]
ENST00000428963 ; ENSP00000393991 ; ENSG00000166451 . [Q96H22-5 ]
ENST00000439957 ; ENSP00000395235 ; ENSG00000166451 . [Q96H22-4 ]
GeneIDi 55839.
KEGGi hsa:55839.
UCSCi uc002ffw.4. human. [Q96H22-2 ]
uc002ffx.2. human. [Q96H22-1 ]

Organism-specific databases

CTDi 55839.
GeneCardsi GC16P081040.
HGNCi HGNC:30873. CENPN.
HPAi HPA052870.
MIMi 611509. gene.
neXtProti NX_Q96H22.
PharmGKBi PA143485397.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG17730.
GeneTreei ENSGT00390000004738.
HOGENOMi HOG000015409.
HOVERGENi HBG058868.
InParanoidi Q96H22.
KOi K11506.
OMAi HEDMEEA.
OrthoDBi EOG7P8PB4.
PhylomeDBi Q96H22.
TreeFami TF329714.

Enzyme and pathway databases

Reactomei REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_22186. Deposition of new CENPA-containing nucleosomes at the centromere.
REACT_682. Mitotic Prometaphase.

Miscellaneous databases

GeneWikii CENPN.
GenomeRNAii 55839.
NextBioi 35472500.
PROi Q96H22.
SOURCEi Search...

Gene expression databases

Bgeei Q96H22.
CleanExi HS_CENPN.
ExpressionAtlasi Q96H22. baseline and differential.
Genevestigatori Q96H22.

Family and domain databases

InterProi IPR027715. CENP-N.
IPR007902. Chl4/mis15/CENP-N.
[Graphical view ]
PANTHERi PTHR32250. PTHR32250. 1 hit.
Pfami PF05238. CENP-N. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel gene expressed in human bone marrow."
    Zhao M., Gu J., Li N., Peng Y., Han Z., Chen Z.
    Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-84.
    Tissue: Bone marrow.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5), VARIANTS ASP-84 AND LYS-288.
    Tissue: Placenta, Small intestine and Subthalamic nucleus.
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASP-84.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-84.
    Tissue: Cervix.
  6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  7. "Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells."
    Izuta H., Ikeno M., Suzuki N., Tomonaga T., Nozaki N., Obuse C., Kisu Y., Goshima N., Nomura F., Nomura N., Yoda K.
    Genes Cells 11:673-684(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  8. "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres."
    Okada M., Cheeseman I.M., Hori T., Okawa K., McLeod I.X., Yates J.R. III, Desai A., Fukagawa T.
    Nat. Cell Biol. 8:446-457(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN A COMPLEX WITH CENPH; CENPI; CENPK; CENPO; CENPP; CENPQ; CENPR AND CENPU.
  9. Cited for: IDENTIFICATION IN THE CENPA-NAC COMPLEX WITH CENPA; CENPC; CENPH; CENPM; CENPT AND CENPU, SUBCELLULAR LOCATION, FUNCTION.
  10. "The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity."
    McClelland S.E., Borusu S., Amaro A.C., Winter J.R., Belwal M., McAinsh A.D., Meraldi P.
    EMBO J. 26:5033-5047(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION.
  11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  13. "Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N."
    Carroll C.W., Silva M.C.C., Godek K.M., Jansen L.E.T., Straight A.F.
    Nat. Cell Biol. 11:896-902(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CENPA, MUTAGENESIS OF ARG-11 AND ARG-196.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiCENPN_HUMAN
AccessioniPrimary (citable) accession number: Q96H22
Secondary accession number(s): A8MZE6
, B3KN53, B4DJD1, B4DPY7, C9JJM5, D3DUK8, E7ES30, E7ETS3, Q9NZ83
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: October 5, 2010
Last modified: October 29, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3