Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96H22

- CENPN_HUMAN

UniProt

Q96H22 - CENPN_HUMAN

Protein

Centromere protein N

Gene

CENPN

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 98 (01 Oct 2014)
      Sequence version 2 (05 Oct 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate.4 Publications

    GO - Biological processi

    1. CENP-A containing nucleosome assembly Source: Reactome
    2. chromosome segregation Source: InterPro
    3. mitotic cell cycle Source: Reactome
    4. mitotic nuclear division Source: InterPro
    5. nucleosome assembly Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_22186. Deposition of new CENPA-containing nucleosomes at the centromere.
    REACT_682. Mitotic Prometaphase.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Centromere protein N
    Short name:
    CENP-N
    Alternative name(s):
    Interphase centromere complex protein 32
    Gene namesi
    Name:CENPN
    Synonyms:C16orf60, ICEN32
    ORF Names:BM-309
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:30873. CENPN.

    Subcellular locationi

    Nucleus. Chromosomecentromerekinetochore
    Note: Localizes exclusively in the kinetochore domain of centromeres. Kinetochore-bound levels decrease when cells enter mitosis and increase again when cells exit mitosis.

    GO - Cellular componenti

    1. condensed chromosome kinetochore Source: UniProtKB-SubCell
    2. cytosol Source: Reactome
    3. nucleoplasm Source: Reactome
    4. nucleus Source: HPA

    Keywords - Cellular componenti

    Centromere, Chromosome, Kinetochore, Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi11 – 111R → A: Decreases the binding to centromeres. 1 Publication
    Mutagenesisi196 – 1961R → A: Decreases the binding to centromeres. 1 Publication

    Organism-specific databases

    PharmGKBiPA143485397.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 339339Centromere protein NPRO_0000249494Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei226 – 2261Phosphoserine5 Publications
    Modified residuei282 – 2821Phosphoserine4 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ96H22.
    PaxDbiQ96H22.
    PRIDEiQ96H22.

    PTM databases

    PhosphoSiteiQ96H22.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96H22.
    BgeeiQ96H22.
    CleanExiHS_CENPN.
    GenevestigatoriQ96H22.

    Organism-specific databases

    HPAiHPA052870.

    Interactioni

    Subunit structurei

    Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and CENPU. The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA.3 Publications

    Protein-protein interaction databases

    BioGridi120942. 13 interactions.
    IntActiQ96H22. 1 interaction.
    MINTiMINT-4995499.
    STRINGi9606.ENSP00000377007.

    Family & Domainsi

    Phylogenomic databases

    eggNOGiNOG17730.
    HOGENOMiHOG000015409.
    HOVERGENiHBG058868.
    KOiK11506.
    OMAiHEDMEEA.
    OrthoDBiEOG7P8PB4.
    PhylomeDBiQ96H22.
    TreeFamiTF329714.

    Family and domain databases

    InterProiIPR027715. CENP-N.
    IPR007902. Chl4/mis15/CENP-N.
    [Graphical view]
    PANTHERiPTHR32250. PTHR32250. 1 hit.
    PfamiPF05238. CENP-N. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96H22-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDETVAEFIK RTILKIPMNE LTTILKAWDF LSENQLQTVN FRQRKESVVQ    50
    HLIHLCEEKR ASISDAALLD IIYMQFHQHQ KVWEVFQMSK GPGEDVDLFD 100
    MKQFKNSFKK ILQRALKNVT VSFRETEENA VWIRIAWGTQ YTKPNQYKPT 150
    YVVYYSQTPY AFTSSSMLRR NTPLLGQALT IASKHHQIVK MDLRSRYLDS 200
    LKAIVFKQYN QTFETHNSTT PLQERSLGLD INMDSRIIHE NIVEKERVQR 250
    ITQETFGDYP QPQLEFAQYK LETKFKSGLN GSILAEREEP LRCLIKFSSP 300
    HLLEALKSLA PAGIADAPLS PLLTCIPNKR MNYFKIRDK 339
    Length:339
    Mass (Da):39,555
    Last modified:October 5, 2010 - v2
    Checksum:i7A0D3326032DE99B
    GO
    Isoform 2 (identifier: Q96H22-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN
         205-339: Missing.

    Show »
    Length:204
    Mass (Da):24,067
    Checksum:i3954E4F78E020360
    GO
    Isoform 3 (identifier: Q96H22-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC

    Note: No experimental confirmation available.

    Show »
    Length:353
    Mass (Da):41,194
    Checksum:iB3366A33C89CD296
    GO
    Isoform 4 (identifier: Q96H22-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         73-93: YMQFHQHQKVWEVFQMSKGPG → C

    Note: No experimental confirmation available.

    Show »
    Length:319
    Mass (Da):37,083
    Checksum:i52873DA13A654ED2
    GO
    Isoform 5 (identifier: Q96H22-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         177-210: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:305
    Mass (Da):35,556
    Checksum:i5D7E6CFAB91045CD
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti139 – 1391T → A in AK026313. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti84 – 841E → D.4 Publications
    Corresponds to variant rs935939 [ dbSNP | Ensembl ].
    VAR_027419
    Natural varianti223 – 2231Q → R.
    Corresponds to variant rs11641523 [ dbSNP | Ensembl ].
    VAR_048689
    Natural varianti288 – 2881E → K.1 Publication
    Corresponds to variant rs2549887 [ dbSNP | Ensembl ].
    VAR_048690

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei73 – 9321YMQFH…SKGPG → C in isoform 4. 1 PublicationVSP_044689Add
    BLAST
    Alternative sequencei177 – 21034Missing in isoform 5. 1 PublicationVSP_044690Add
    BLAST
    Alternative sequencei178 – 20427ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. 2 PublicationsVSP_020441Add
    BLAST
    Alternative sequencei205 – 339135Missing in isoform 2. 2 PublicationsVSP_020442Add
    BLAST
    Alternative sequencei313 – 33927GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. 1 PublicationVSP_044565Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF217515 mRNA. Translation: AAF67626.1.
    AK023669 mRNA. Translation: BAG51215.1.
    AK026313 mRNA. No translation available.
    AK298554 mRNA. Translation: BAG60749.1.
    AK296024 mRNA. Translation: BAG58793.1.
    AC092718 Genomic DNA. No translation available.
    CH471114 Genomic DNA. Translation: EAW95553.1.
    CH471114 Genomic DNA. Translation: EAW95556.1.
    BC007334 mRNA. Translation: AAH07334.1.
    BC008972 mRNA. Translation: AAH08972.1.
    CCDSiCCDS10931.1. [Q96H22-2]
    CCDS42199.1. [Q96H22-3]
    CCDS42200.1. [Q96H22-1]
    CCDS58482.1. [Q96H22-5]
    CCDS58483.1. [Q96H22-4]
    RefSeqiNP_001094094.2. NM_001100624.2. [Q96H22-1]
    NP_001094095.2. NM_001100625.2. [Q96H22-3]
    NP_001257402.1. NM_001270473.1. [Q96H22-4]
    NP_001257403.1. NM_001270474.1. [Q96H22-5]
    NP_060925.2. NM_018455.5. [Q96H22-2]
    XP_006721299.1. XM_006721236.1. [Q96H22-1]
    UniGeneiHs.726537.

    Genome annotation databases

    EnsembliENST00000299572; ENSP00000299572; ENSG00000166451. [Q96H22-2]
    ENST00000305850; ENSP00000305608; ENSG00000166451. [Q96H22-1]
    ENST00000393335; ENSP00000377007; ENSG00000166451. [Q96H22-3]
    ENST00000428963; ENSP00000393991; ENSG00000166451. [Q96H22-5]
    ENST00000439957; ENSP00000395235; ENSG00000166451. [Q96H22-4]
    GeneIDi55839.
    KEGGihsa:55839.
    UCSCiuc002ffw.4. human. [Q96H22-2]
    uc002ffx.2. human. [Q96H22-1]

    Polymorphism databases

    DMDMi308153423.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF217515 mRNA. Translation: AAF67626.1 .
    AK023669 mRNA. Translation: BAG51215.1 .
    AK026313 mRNA. No translation available.
    AK298554 mRNA. Translation: BAG60749.1 .
    AK296024 mRNA. Translation: BAG58793.1 .
    AC092718 Genomic DNA. No translation available.
    CH471114 Genomic DNA. Translation: EAW95553.1 .
    CH471114 Genomic DNA. Translation: EAW95556.1 .
    BC007334 mRNA. Translation: AAH07334.1 .
    BC008972 mRNA. Translation: AAH08972.1 .
    CCDSi CCDS10931.1. [Q96H22-2 ]
    CCDS42199.1. [Q96H22-3 ]
    CCDS42200.1. [Q96H22-1 ]
    CCDS58482.1. [Q96H22-5 ]
    CCDS58483.1. [Q96H22-4 ]
    RefSeqi NP_001094094.2. NM_001100624.2. [Q96H22-1 ]
    NP_001094095.2. NM_001100625.2. [Q96H22-3 ]
    NP_001257402.1. NM_001270473.1. [Q96H22-4 ]
    NP_001257403.1. NM_001270474.1. [Q96H22-5 ]
    NP_060925.2. NM_018455.5. [Q96H22-2 ]
    XP_006721299.1. XM_006721236.1. [Q96H22-1 ]
    UniGenei Hs.726537.

    3D structure databases

    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120942. 13 interactions.
    IntActi Q96H22. 1 interaction.
    MINTi MINT-4995499.
    STRINGi 9606.ENSP00000377007.

    PTM databases

    PhosphoSitei Q96H22.

    Polymorphism databases

    DMDMi 308153423.

    Proteomic databases

    MaxQBi Q96H22.
    PaxDbi Q96H22.
    PRIDEi Q96H22.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000299572 ; ENSP00000299572 ; ENSG00000166451 . [Q96H22-2 ]
    ENST00000305850 ; ENSP00000305608 ; ENSG00000166451 . [Q96H22-1 ]
    ENST00000393335 ; ENSP00000377007 ; ENSG00000166451 . [Q96H22-3 ]
    ENST00000428963 ; ENSP00000393991 ; ENSG00000166451 . [Q96H22-5 ]
    ENST00000439957 ; ENSP00000395235 ; ENSG00000166451 . [Q96H22-4 ]
    GeneIDi 55839.
    KEGGi hsa:55839.
    UCSCi uc002ffw.4. human. [Q96H22-2 ]
    uc002ffx.2. human. [Q96H22-1 ]

    Organism-specific databases

    CTDi 55839.
    GeneCardsi GC16P081040.
    HGNCi HGNC:30873. CENPN.
    HPAi HPA052870.
    MIMi 611509. gene.
    neXtProti NX_Q96H22.
    PharmGKBi PA143485397.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG17730.
    HOGENOMi HOG000015409.
    HOVERGENi HBG058868.
    KOi K11506.
    OMAi HEDMEEA.
    OrthoDBi EOG7P8PB4.
    PhylomeDBi Q96H22.
    TreeFami TF329714.

    Enzyme and pathway databases

    Reactomei REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_22186. Deposition of new CENPA-containing nucleosomes at the centromere.
    REACT_682. Mitotic Prometaphase.

    Miscellaneous databases

    GeneWikii CENPN.
    GenomeRNAii 55839.
    NextBioi 35472500.
    PROi Q96H22.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96H22.
    Bgeei Q96H22.
    CleanExi HS_CENPN.
    Genevestigatori Q96H22.

    Family and domain databases

    InterProi IPR027715. CENP-N.
    IPR007902. Chl4/mis15/CENP-N.
    [Graphical view ]
    PANTHERi PTHR32250. PTHR32250. 1 hit.
    Pfami PF05238. CENP-N. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel gene expressed in human bone marrow."
      Zhao M., Gu J., Li N., Peng Y., Han Z., Chen Z.
      Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-84.
      Tissue: Bone marrow.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5), VARIANTS ASP-84 AND LYS-288.
      Tissue: Placenta, Small intestine and Subthalamic nucleus.
    3. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASP-84.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-84.
      Tissue: Cervix.
    6. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    7. "Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells."
      Izuta H., Ikeno M., Suzuki N., Tomonaga T., Nozaki N., Obuse C., Kisu Y., Goshima N., Nomura F., Nomura N., Yoda K.
      Genes Cells 11:673-684(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.
    8. "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres."
      Okada M., Cheeseman I.M., Hori T., Okawa K., McLeod I.X., Yates J.R. III, Desai A., Fukagawa T.
      Nat. Cell Biol. 8:446-457(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION IN A COMPLEX WITH CENPH; CENPI; CENPK; CENPO; CENPP; CENPQ; CENPR AND CENPU.
    9. Cited for: IDENTIFICATION IN THE CENPA-NAC COMPLEX WITH CENPA; CENPC; CENPH; CENPM; CENPT AND CENPU, SUBCELLULAR LOCATION, FUNCTION.
    10. "The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity."
      McClelland S.E., Borusu S., Amaro A.C., Winter J.R., Belwal M., McAinsh A.D., Meraldi P.
      EMBO J. 26:5033-5047(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION.
    11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N."
      Carroll C.W., Silva M.C.C., Godek K.M., Jansen L.E.T., Straight A.F.
      Nat. Cell Biol. 11:896-902(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, INTERACTION WITH CENPA, MUTAGENESIS OF ARG-11 AND ARG-196.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiCENPN_HUMAN
    AccessioniPrimary (citable) accession number: Q96H22
    Secondary accession number(s): A8MZE6
    , B3KN53, B4DJD1, B4DPY7, C9JJM5, D3DUK8, E7ES30, E7ETS3, Q9NZ83
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 19, 2006
    Last sequence update: October 5, 2010
    Last modified: October 1, 2014
    This is version 98 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

    External Data

    Dasty 3