Q96H22 (CENPN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Centromere protein N Short name=CENP-N Alternative name(s): Interphase centromere complex protein 32 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 339 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. CENPN is the first protein to bind specifically to CENPA nucleosomes and the direct binding of CENPA nucleosomes by CENPN is required for centromere assembly. Required for chromosome congression and efficiently align the chromosomes on a metaphase plate. Ref.7 Ref.9 Ref.10 Ref.13 |
| Subunit structure | Component of the CENPA-NAC complex, at least composed of CENPA, CENPC, CENPH, CENPM, CENPN, CENPT and MLF1IP/CENPU. The CENPA-NAC complex interacts with the CENPA-CAD complex, composed of CENPI, CENPK, CENPL, CENPO, CENPP, CENPQ, CENPR and CENPS. Interacts directly with CENPA. Ref.8 Ref.9 Ref.13 |
| Subcellular location | Nucleus. Chromosome › centromere › kinetochore. Note: Localizes exclusively in the kinetochore domain of centromeres. Kinetochore-bound levels decrease when cells enter mitosis and increase again when cells exit mitosis. Ref.7 Ref.9 Ref.10 |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Centromere Chromosome Kinetochore Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | CENP-A containing nucleosome assembly at centromere Traceable author statement. Source: Reactome mitotic prometaphaseTraceable author statement. Source: Reactome |
| Cellular_component | condensed chromosome kinetochore Inferred from electronic annotation. Source: UniProtKB-SubCell cytosolTraceable author statement. Source: Reactome nucleoplasmTraceable author statement. Source: Reactome |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96H22-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96H22-2) The sequence of this isoform differs from the canonical sequence as follows: 178-204: ALTIASKHHQIVKMDLRSRYLDSLKAI → ELEATGKIYLRQEEIILDITEMKKACN 205-339: Missing. | ||||||
| Isoform 3 (identifier: Q96H22-3) The sequence of this isoform differs from the canonical sequence as follows: 313-339: GIADAPLSPLLTCIPNKRMNYFKIRDK → ALVCRIQKLLCYSGSHSQGTQDPSSWQKDLYLLFVPLYPRC | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 4 (identifier: Q96H22-4) The sequence of this isoform differs from the canonical sequence as follows: 73-93: YMQFHQHQKVWEVFQMSKGPG → C | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 5 (identifier: Q96H22-5) The sequence of this isoform differs from the canonical sequence as follows: 177-210: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 339 | 339 | Centromere protein N | PRO_0000249494 | |||||
Amino acid modifications | |||||||||
| Modified residue | 226 | 1 | Phosphoserine Ref.6 Ref.11 Ref.12 Ref.14 Ref.15 | ||||||
| Modified residue | 282 | 1 | Phosphoserine Ref.11 Ref.12 Ref.14 Ref.15 | ||||||
Natural variations | |||||||||
| Alternative sequence | 73 – 93 | 21 | YMQFH…SKGPG → C in isoform 4. | VSP_044689 | |||||
| Alternative sequence | 177 – 210 | 34 | Missing in isoform 5. | VSP_044690 | |||||
| Alternative sequence | 178 – 204 | 27 | ALTIA…SLKAI → ELEATGKIYLRQEEIILDIT EMKKACN in isoform 2. | VSP_020441 | |||||
| Alternative sequence | 205 – 339 | 135 | Missing in isoform 2. | VSP_020442 | |||||
| Alternative sequence | 313 – 339 | 27 | GIADA…KIRDK → ALVCRIQKLLCYSGSHSQGT QDPSSWQKDLYLLFVPLYPR C in isoform 3. | VSP_044565 | |||||
| Natural variant | 84 | 1 | E → D. Ref.1 Ref.2 Ref.4 Ref.5 Corresponds to variant rs935939 [ dbSNP | Ensembl ]. | VAR_027419 | |||||
| Natural variant | 223 | 1 | Q → R. Corresponds to variant rs11641523 [ dbSNP | Ensembl ]. | VAR_048689 | |||||
| Natural variant | 288 | 1 | E → K. Ref.2 Corresponds to variant rs2549887 [ dbSNP | Ensembl ]. | VAR_048690 | |||||
Experimental info | |||||||||
| Mutagenesis | 11 | 1 | R → A: Decreases the binding to centromeres. Ref.13 | ||||||
| Mutagenesis | 196 | 1 | R → A: Decreases the binding to centromeres. Ref.13 | ||||||
| Sequence conflict | 139 | 1 | T → A in AK026313. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel gene expressed in human bone marrow." Zhao M., Gu J., Li N., Peng Y., Han Z., Chen Z. Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT ASP-84. Tissue: Bone marrow. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3; 4 AND 5), VARIANTS ASP-84 AND LYS-288. Tissue: Placenta, Small intestine and Subthalamic nucleus. |
| [3] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT ASP-84. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT ASP-84. Tissue: Cervix. |
| [6] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells." Izuta H., Ikeno M., Suzuki N., Tomonaga T., Nozaki N., Obuse C., Kisu Y., Goshima N., Nomura F., Nomura N., Yoda K. Genes Cells 11:673-684(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [8] | "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres." Okada M., Cheeseman I.M., Hori T., Okawa K., McLeod I.X., Yates J.R. III, Desai A., Fukagawa T. Nat. Cell Biol. 8:446-457(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN A COMPLEX WITH CENPH; CENPI; CENPK; CENPO; CENPP; CENPQ; CENPR AND CENPU. |
| [9] | "The human CENP-A centromeric nucleosome-associated complex." Foltz D.R., Jansen L.E.T., Black B.E., Bailey A.O., Yates J.R. III, Cleveland D.W. Nat. Cell Biol. 8:458-469(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE CENPA-NAC COMPLEX WITH CENPA; CENPC; CENPH; CENPM; CENPT AND CENPU, SUBCELLULAR LOCATION, FUNCTION. |
| [10] | "The CENP-A NAC/CAD kinetochore complex controls chromosome congression and spindle bipolarity." McClelland S.E., Borusu S., Amaro A.C., Winter J.R., Belwal M., McAinsh A.D., Meraldi P. EMBO J. 26:5033-5047(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [11] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Centromere assembly requires the direct recognition of CENP-A nucleosomes by CENP-N." Carroll C.W., Silva M.C.C., Godek K.M., Jansen L.E.T., Straight A.F. Nat. Cell Biol. 11:896-902(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CENPA, MUTAGENESIS OF ARG-11 AND ARG-196. |
| [14] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-226 AND SER-282, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF217515 mRNA. Translation: AAF67626.1. AK023669 mRNA. Translation: BAG51215.1. AK026313 mRNA. No translation available. AK298554 mRNA. Translation: BAG60749.1. AK296024 mRNA. Translation: BAG58793.1. AC092718 Genomic DNA. No translation available. CH471114 Genomic DNA. Translation: EAW95553.1. CH471114 Genomic DNA. Translation: EAW95556.1. BC007334 mRNA. Translation: AAH07334.1. BC008972 mRNA. Translation: AAH08972.1. |
| IPI | IPI00020485. IPI00305656. IPI00645096. IPI00908795. IPI00909615. |
| RefSeq | NP_001094094.2. NM_001100624.2. NP_001094095.2. NM_001100625.2. NP_001257402.1. NM_001270473.1. NP_001257403.1. NM_001270474.1. NP_060925.2. NM_018455.5. |
| UniGene | Hs.726537. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96H22. 1 interaction. |
| STRING | 9606.ENSP00000377007. |
PTM databases | |
| PhosphoSite | Q96H22. |
Polymorphism databases | |
| DMDM | 308153423. |
Proteomic databases | |
| PaxDb | Q96H22. |
| PRIDE | Q96H22. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000299572; ENSP00000299572; ENSG00000166451. ENST00000305850; ENSP00000305608; ENSG00000166451. ENST00000393335; ENSP00000377007; ENSG00000166451. ENST00000428963; ENSP00000393991; ENSG00000166451. ENST00000439957; ENSP00000395235; ENSG00000166451. |
| GeneID | 55839. |
| KEGG | hsa:55839. |
| UCSC | uc002ffx.2. human. |
Organism-specific databases | |
| CTD | 55839. |
| GeneCards | GC16P081040. |
| HGNC | HGNC:30873. CENPN. |
| MIM | 611509. gene. |
| neXtProt | NX_Q96H22. |
| PharmGKB | PA143485397. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG17730. |
| HOGENOM | HOG000015409. |
| HOVERGEN | HBG058868. |
| KO | K11506. |
| OMA | MTILKAW. |
| OrthoDB | EOG4QZ7M6. |
| PhylomeDB | Q96H22. |
Enzyme and pathway databases | |
| Reactome | REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. |
Gene expression databases | |
| ArrayExpress | Q96H22. |
| Bgee | Q96H22. |
| CleanEx | HS_CENPN. |
| Genevestigator | Q96H22. |
| GermOnline | ENSG00000166451. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007902. CHL4. [Graphical view] |
| Pfam | PF05238. CENP-N. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 55839. |
| NextBio | 35472500. |
| SOURCE | Search... |
Entry information
| Entry name | CENPN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96H22 Secondary accession number(s): A8MZE6 Q9NZ83 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with
