Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96GZ6 (S41A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 95. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Solute carrier family 41 member 3
Gene names
Name:SLC41A3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length507 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Cell membrane; Multi-pass membrane protein.

Sequence similarities

Belongs to the SLC41A transporter family.

Ontologies

Alternative products

This entry describes 9 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96GZ6-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96GZ6-2)

The sequence of this isoform differs from the canonical sequence as follows:
     501-507: Missing.
Isoform 3 (identifier: Q96GZ6-3)

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.
Isoform 4 (identifier: Q96GZ6-4)

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.
     501-507: Missing.
Isoform 5 (identifier: Q96GZ6-5)

The sequence of this isoform differs from the canonical sequence as follows:
     61-69: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP
Isoform 6 (identifier: Q96GZ6-6)

The sequence of this isoform differs from the canonical sequence as follows:
     218-266: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP
Isoform 7 (identifier: Q96GZ6-7)

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-90: STGGLPVASE...SWAGMLLDYF → MVVTQLNLEF...MTAGLVMNTI
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP
Isoform 8 (identifier: Q96GZ6-8)

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP
Note: No experimental confirmation available.
Isoform 9 (identifier: Q96GZ6-9)

The sequence of this isoform differs from the canonical sequence as follows:
     457-487: SSSVGHTAAVPRRCTASPGWGLIQPFICTQH → TGLLALCFFTDWLLKSKAELGGISELASGPP
     488-507: Missing.
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 507507Solute carrier family 41 member 3
PRO_0000295592

Regions

Transmembrane67 – 8721Helical; Potential
Transmembrane152 – 17221Helical; Potential
Transmembrane189 – 20921Helical; Potential
Transmembrane220 – 24021Helical; Potential
Transmembrane252 – 27221Helical; Potential
Transmembrane284 – 30421Helical; Potential
Transmembrane314 – 33421Helical; Potential
Transmembrane377 – 39721Helical; Potential
Transmembrane406 – 42621Helical; Potential
Transmembrane482 – 50221Helical; Potential
Compositional bias378 – 3814Poly-Leu

Natural variations

Alternative sequence1 – 117117Missing in isoform 8.
VSP_043676
Alternative sequence1 – 2626Missing in isoform 7.
VSP_035505
Alternative sequence27 – 9064STGGL…LLDYF → MVVTQLNLEFCFQGKKLRGF SCELTRSPHGVLPESFFTIM CQVVVPILLSGLCMMTAGLV MNTI in isoform 7.
VSP_035506
Alternative sequence61 – 699Missing in isoform 5.
VSP_026934
Alternative sequence92 – 12736Missing in isoform 3 and isoform 4.
VSP_026935
Alternative sequence218 – 26649Missing in isoform 6.
VSP_026936
Alternative sequence457 – 50751SSSVG…AKTSI → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 5, isoform 6, isoform 7 and isoform 8.
VSP_026937
Alternative sequence457 – 48731SSSVG…ICTQH → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 9.
VSP_054059
Alternative sequence488 – 50720Missing in isoform 9.
VSP_054060
Alternative sequence501 – 5077Missing in isoform 2 and isoform 4.
VSP_026938
Natural variant621T → A. Ref.1 Ref.3
Corresponds to variant rs4234270 [ dbSNP | Ensembl ].
VAR_033296
Natural variant711V → M. Ref.1
Corresponds to variant rs11543283 [ dbSNP | Ensembl ].
VAR_046667

Experimental info

Sequence conflict3311A → G in BAC03717. Ref.1
Sequence conflict3871L → P in BAB13938. Ref.1
Sequence conflict4051Q → R in BAC03717. Ref.1
Sequence conflict4481L → P in BAB13938. Ref.1
Isoform 7:
Sequence conflict4321G → S in BAG52701. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified November 30, 2010. Version 2.
Checksum: EA2C1C9216F01AA1

FASTA50754,767
        10         20         30         40         50         60 
MDGTETRQRR LDSCGKPGEL GLPHPLSTGG LPVASEDGAL RAPESQSVTP KPLETEPSRE 

        70         80         90        100        110        120 
TTWSIGLQVT VPFMFAGLGL SWAGMLLDYF QHWPVFVEVK DLLTLVPPLV GLKGNLEMTL 

       130        140        150        160        170        180 
ASRLSTAANT GQIDDPQEQH RVISSNLALI QVQATVVGLL AAVAALLLGV VSREEVDVAK 

       190        200        210        220        230        240 
VELLCASSVL TAFLAAFALG VLMVCIVIGA RKLGVNPDNI ATPIAASLGD LITLSILALV 

       250        260        270        280        290        300 
SSFFYRHKDS RYLTPLVCLS FAALTPVWVL IAKQSPPIVK ILKFGWFPII LAMVISSFGG 

       310        320        330        340        350        360 
LILSKTVSKQ QYKGMAIFTP VICGVGGNLV AIQTSRISTY LHMWSAPGVL PLQMKKFWPN 

       370        380        390        400        410        420 
PCSTFCTSEI NSMSARVLLL LVVPGHLIFF YIIYLVEGQS VINSQTFVVL YLLAGLIQVT 

       430        440        450        460        470        480 
ILLYLAEVMV RLTWHQALDP DNHCIPYLTG LGDLLGSSSV GHTAAVPRRC TASPGWGLIQ 

       490        500 
PFICTQHLIV SLLSFYFPFC LLAKTSI 

« Hide

Isoform 2 [UniParc].

Checksum: 01EE7EF739103D9A
Show »

FASTA50054,040
Isoform 3 [UniParc].

Checksum: 077454E8023458E1
Show »

FASTA47150,839
Isoform 4 [UniParc].

Checksum: 014C542234BD1E66
Show »

FASTA46450,112
Isoform 5 [UniParc].

Checksum: 073256C0E3E0035D
Show »

FASTA47851,493
Isoform 6 [UniParc].

Checksum: B5C3D56EE1863859
Show »

FASTA43847,200
Isoform 7 [UniParc].

Checksum: DB62D800839C29A0
Show »

FASTA46149,916
Isoform 8 [UniParc].

Checksum: 8FC413D1A828CB95
Show »

FASTA37039,828
Isoform 9 [UniParc].

Checksum: 33C81692DC272150
Show »

FASTA48752,479

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6; 7 AND 8), VARIANTS ALA-62 AND MET-71.
Tissue: Brain, Lung and Testis.
[2]"The DNA sequence, annotation and analysis of human chromosome 3."
Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J. expand/collapse author list , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 9), VARIANT ALA-62.
Tissue: Brain and Colon.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000480 mRNA. Translation: BAA91192.1.
AK021925 mRNA. Translation: BAB13938.1.
AK022780 mRNA. Translation: BAB14241.1.
AK091671 mRNA. Translation: BAC03717.1.
AK093380 mRNA. Translation: BAG52701.1.
AK298070 mRNA. Translation: BAH12718.1.
AC079848 Genomic DNA. No translation available.
AC092903 Genomic DNA. No translation available.
AC117422 Genomic DNA. No translation available.
BC009444 mRNA. No translation available.
BC009039 mRNA. Translation: AAH09039.1.
BC028241 mRNA. Translation: AAH28241.1.
RefSeqNP_001008485.1. NM_001008485.1.
NP_001008486.1. NM_001008486.1.
NP_001008487.1. NM_001008487.1.
NP_001157947.1. NM_001164475.1.
XP_005247618.1. XM_005247561.1.
XP_005247619.1. XM_005247562.1.
XP_005247620.1. XM_005247563.1.
UniGeneHs.573007.

3D structure databases

ProteinModelPortalQ96GZ6.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120285. 3 interactions.
IntActQ96GZ6. 2 interactions.
MINTMINT-4933371.

Protein family/group databases

TCDB1.A.26.2.3. the mg(2+) transporter-e (mgte) family.

PTM databases

PhosphoSiteQ96GZ6.

Polymorphism databases

DMDM313104184.

Proteomic databases

PaxDbQ96GZ6.
PRIDEQ96GZ6.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000315891; ENSP00000326070; ENSG00000114544. [Q96GZ6-1]
ENST00000346785; ENSP00000264471; ENSG00000114544. [Q96GZ6-3]
ENST00000360370; ENSP00000353533; ENSG00000114544.
ENST00000383598; ENSP00000373092; ENSG00000114544. [Q96GZ6-7]
ENST00000508835; ENSP00000427409; ENSG00000114544. [Q96GZ6-8]
GeneID54946.
KEGGhsa:54946.
UCSCuc003eii.3. human. [Q96GZ6-7]
uc003eij.3. human. [Q96GZ6-1]
uc011bkh.2. human. [Q96GZ6-8]

Organism-specific databases

CTD54946.
GeneCardsGC03M125725.
HGNCHGNC:31046. SLC41A3.
HPAHPA045847.
MIM610803. gene.
neXtProtNX_Q96GZ6.
PharmGKBPA134878151.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1824.
HOGENOMHOG000007017.
HOVERGENHBG057187.
InParanoidQ96GZ6.
KOK15122.
OMATFCSSEI.
PhylomeDBQ96GZ6.
TreeFamTF313647.

Gene expression databases

ArrayExpressQ96GZ6.
BgeeQ96GZ6.
CleanExHS_SLC41A3.
GenevestigatorQ96GZ6.

Family and domain databases

Gene3D1.10.357.20. 2 hits.
InterProIPR006667. SLC41_membr_dom.
[Graphical view]
PfamPF01769. MgtE. 2 hits.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSLC41A3.
GenomeRNAi54946.
NextBio58101.
PROQ96GZ6.
SOURCESearch...

Entry information

Entry nameS41A3_HUMAN
AccessionPrimary (citable) accession number: Q96GZ6
Secondary accession number(s): A6ND60 expand/collapse secondary AC list , B3KSD9, B7Z4Y2, C9JE96, E7ENY4, Q8N342, Q8NB27, Q9H9I6, Q9HAB1, Q9NX30
Entry history
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 30, 2010
Last modified: April 16, 2014
This is version 95 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 3

Human chromosome 3: entries, gene names and cross-references to MIM