Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96GZ6

- S41A3_HUMAN

UniProt

Q96GZ6 - S41A3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Solute carrier family 41 member 3

Gene

SLC41A3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  1. cation transmembrane transporter activity Source: InterPro
Complete GO annotation...

Protein family/group databases

TCDBi1.A.26.2.3. the mg(2+) transporter-e (mgte) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier family 41 member 3
Gene namesi
Name:SLC41A3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 3

Organism-specific databases

HGNCiHGNC:31046. SLC41A3.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134878151.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 507507Solute carrier family 41 member 3PRO_0000295592Add
BLAST

Proteomic databases

MaxQBiQ96GZ6.
PaxDbiQ96GZ6.
PRIDEiQ96GZ6.

PTM databases

PhosphoSiteiQ96GZ6.

Expressioni

Gene expression databases

BgeeiQ96GZ6.
CleanExiHS_SLC41A3.
ExpressionAtlasiQ96GZ6. baseline and differential.
GenevestigatoriQ96GZ6.

Organism-specific databases

HPAiHPA045847.

Interactioni

Protein-protein interaction databases

BioGridi120285. 4 interactions.
IntActiQ96GZ6. 2 interactions.
MINTiMINT-4933371.

Structurei

3D structure databases

ProteinModelPortaliQ96GZ6.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei67 – 8721HelicalSequence AnalysisAdd
BLAST
Transmembranei152 – 17221HelicalSequence AnalysisAdd
BLAST
Transmembranei189 – 20921HelicalSequence AnalysisAdd
BLAST
Transmembranei220 – 24021HelicalSequence AnalysisAdd
BLAST
Transmembranei252 – 27221HelicalSequence AnalysisAdd
BLAST
Transmembranei284 – 30421HelicalSequence AnalysisAdd
BLAST
Transmembranei314 – 33421HelicalSequence AnalysisAdd
BLAST
Transmembranei377 – 39721HelicalSequence AnalysisAdd
BLAST
Transmembranei406 – 42621HelicalSequence AnalysisAdd
BLAST
Transmembranei482 – 50221HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi378 – 3814Poly-Leu

Sequence similaritiesi

Belongs to the SLC41A transporter family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiCOG1824.
GeneTreeiENSGT00390000016816.
HOGENOMiHOG000007017.
HOVERGENiHBG057187.
InParanoidiQ96GZ6.
KOiK15122.
OMAiTFCSSEI.
PhylomeDBiQ96GZ6.
TreeFamiTF313647.

Family and domain databases

Gene3Di1.10.357.20. 2 hits.
InterProiIPR006667. SLC41_membr_dom.
[Graphical view]
PfamiPF01769. MgtE. 2 hits.
[Graphical view]

Sequences (9)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96GZ6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGTETRQRR LDSCGKPGEL GLPHPLSTGG LPVASEDGAL RAPESQSVTP
60 70 80 90 100
KPLETEPSRE TTWSIGLQVT VPFMFAGLGL SWAGMLLDYF QHWPVFVEVK
110 120 130 140 150
DLLTLVPPLV GLKGNLEMTL ASRLSTAANT GQIDDPQEQH RVISSNLALI
160 170 180 190 200
QVQATVVGLL AAVAALLLGV VSREEVDVAK VELLCASSVL TAFLAAFALG
210 220 230 240 250
VLMVCIVIGA RKLGVNPDNI ATPIAASLGD LITLSILALV SSFFYRHKDS
260 270 280 290 300
RYLTPLVCLS FAALTPVWVL IAKQSPPIVK ILKFGWFPII LAMVISSFGG
310 320 330 340 350
LILSKTVSKQ QYKGMAIFTP VICGVGGNLV AIQTSRISTY LHMWSAPGVL
360 370 380 390 400
PLQMKKFWPN PCSTFCTSEI NSMSARVLLL LVVPGHLIFF YIIYLVEGQS
410 420 430 440 450
VINSQTFVVL YLLAGLIQVT ILLYLAEVMV RLTWHQALDP DNHCIPYLTG
460 470 480 490 500
LGDLLGSSSV GHTAAVPRRC TASPGWGLIQ PFICTQHLIV SLLSFYFPFC

LLAKTSI
Length:507
Mass (Da):54,767
Last modified:November 30, 2010 - v2
Checksum:iEA2C1C9216F01AA1
GO
Isoform 2 (identifier: Q96GZ6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     501-507: Missing.

Show »
Length:500
Mass (Da):54,040
Checksum:i01EE7EF739103D9A
GO
Isoform 3 (identifier: Q96GZ6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.

Show »
Length:471
Mass (Da):50,839
Checksum:i077454E8023458E1
GO
Isoform 4 (identifier: Q96GZ6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     92-127: Missing.
     501-507: Missing.

Show »
Length:464
Mass (Da):50,112
Checksum:i014C542234BD1E66
GO
Isoform 5 (identifier: Q96GZ6-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-69: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:478
Mass (Da):51,493
Checksum:i073256C0E3E0035D
GO
Isoform 6 (identifier: Q96GZ6-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     218-266: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:438
Mass (Da):47,200
Checksum:iB5C3D56EE1863859
GO
Isoform 7 (identifier: Q96GZ6-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-26: Missing.
     27-90: STGGLPVASE...SWAGMLLDYF → MVVTQLNLEF...MTAGLVMNTI
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Show »
Length:461
Mass (Da):49,916
Checksum:iDB62D800839C29A0
GO
Isoform 8 (identifier: Q96GZ6-8) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-117: Missing.
     457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

Note: No experimental confirmation available.

Show »
Length:370
Mass (Da):39,828
Checksum:i8FC413D1A828CB95
GO
Isoform 9 (identifier: Q96GZ6-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     457-487: SSSVGHTAAVPRRCTASPGWGLIQPFICTQH → TGLLALCFFTDWLLKSKAELGGISELASGPP
     488-507: Missing.

Note: No experimental confirmation available.

Show »
Length:487
Mass (Da):52,479
Checksum:i33C81692DC272150
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti331 – 3311A → G in BAC03717. (PubMed:14702039)Curated
Sequence conflicti387 – 3871L → P in BAB13938. (PubMed:14702039)Curated
Sequence conflicti405 – 4051Q → R in BAC03717. (PubMed:14702039)Curated
Sequence conflicti448 – 4481L → P in BAB13938. (PubMed:14702039)Curated
Isoform 7 (identifier: Q96GZ6-7)
Sequence conflicti432 – 4321G → S in BAG52701. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti62 – 621T → A.2 Publications
Corresponds to variant rs4234270 [ dbSNP | Ensembl ].
VAR_033296
Natural varianti71 – 711V → M.1 Publication
Corresponds to variant rs11543283 [ dbSNP | Ensembl ].
VAR_046667

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 117117Missing in isoform 8. 1 PublicationVSP_043676Add
BLAST
Alternative sequencei1 – 2626Missing in isoform 7. 1 PublicationVSP_035505Add
BLAST
Alternative sequencei27 – 9064STGGL…LLDYF → MVVTQLNLEFCFQGKKLRGF SCELTRSPHGVLPESFFTIM CQVVVPILLSGLCMMTAGLV MNTI in isoform 7. 1 PublicationVSP_035506Add
BLAST
Alternative sequencei61 – 699Missing in isoform 5. 1 PublicationVSP_026934
Alternative sequencei92 – 12736Missing in isoform 3 and isoform 4. 1 PublicationVSP_026935Add
BLAST
Alternative sequencei218 – 26649Missing in isoform 6. 1 PublicationVSP_026936Add
BLAST
Alternative sequencei457 – 50751SSSVG…AKTSI → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 5, isoform 6, isoform 7 and isoform 8. 1 PublicationVSP_026937Add
BLAST
Alternative sequencei457 – 48731SSSVG…ICTQH → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 9. 1 PublicationVSP_054059Add
BLAST
Alternative sequencei488 – 50720Missing in isoform 9. 1 PublicationVSP_054060Add
BLAST
Alternative sequencei501 – 5077Missing in isoform 2 and isoform 4. 2 PublicationsVSP_026938

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000480 mRNA. Translation: BAA91192.1.
AK021925 mRNA. Translation: BAB13938.1.
AK022780 mRNA. Translation: BAB14241.1.
AK091671 mRNA. Translation: BAC03717.1.
AK093380 mRNA. Translation: BAG52701.1.
AK298070 mRNA. Translation: BAH12718.1.
AC079848 Genomic DNA. No translation available.
AC092903 Genomic DNA. No translation available.
AC117422 Genomic DNA. No translation available.
BC009444 mRNA. No translation available.
BC009039 mRNA. Translation: AAH09039.1.
BC028241 mRNA. Translation: AAH28241.1.
CCDSiCCDS33842.1. [Q96GZ6-3]
CCDS33843.1. [Q96GZ6-1]
CCDS33844.1. [Q96GZ6-7]
CCDS43144.1. [Q96GZ6-9]
CCDS54635.1. [Q96GZ6-8]
RefSeqiNP_001008485.1. NM_001008485.1.
NP_001008486.1. NM_001008486.1.
NP_001008487.1. NM_001008487.1. [Q96GZ6-7]
NP_001157947.1. NM_001164475.1. [Q96GZ6-8]
XP_005247618.1. XM_005247561.1. [Q96GZ6-1]
XP_005247619.1. XM_005247562.1. [Q96GZ6-1]
XP_005247620.1. XM_005247563.1. [Q96GZ6-1]
XP_006713744.1. XM_006713681.1. [Q96GZ6-1]
UniGeneiHs.573007.

Genome annotation databases

EnsembliENST00000315891; ENSP00000326070; ENSG00000114544. [Q96GZ6-1]
ENST00000346785; ENSP00000264471; ENSG00000114544. [Q96GZ6-3]
ENST00000360370; ENSP00000353533; ENSG00000114544. [Q96GZ6-9]
ENST00000383598; ENSP00000373092; ENSG00000114544. [Q96GZ6-7]
ENST00000508835; ENSP00000427409; ENSG00000114544. [Q96GZ6-8]
ENST00000612940; ENSP00000480188; ENSG00000114544. [Q96GZ6-2]
GeneIDi54946.
KEGGihsa:54946.
UCSCiuc003eii.3. human. [Q96GZ6-7]
uc003eij.3. human. [Q96GZ6-1]
uc011bkh.2. human. [Q96GZ6-8]

Polymorphism databases

DMDMi313104184.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000480 mRNA. Translation: BAA91192.1 .
AK021925 mRNA. Translation: BAB13938.1 .
AK022780 mRNA. Translation: BAB14241.1 .
AK091671 mRNA. Translation: BAC03717.1 .
AK093380 mRNA. Translation: BAG52701.1 .
AK298070 mRNA. Translation: BAH12718.1 .
AC079848 Genomic DNA. No translation available.
AC092903 Genomic DNA. No translation available.
AC117422 Genomic DNA. No translation available.
BC009444 mRNA. No translation available.
BC009039 mRNA. Translation: AAH09039.1 .
BC028241 mRNA. Translation: AAH28241.1 .
CCDSi CCDS33842.1. [Q96GZ6-3 ]
CCDS33843.1. [Q96GZ6-1 ]
CCDS33844.1. [Q96GZ6-7 ]
CCDS43144.1. [Q96GZ6-9 ]
CCDS54635.1. [Q96GZ6-8 ]
RefSeqi NP_001008485.1. NM_001008485.1.
NP_001008486.1. NM_001008486.1.
NP_001008487.1. NM_001008487.1. [Q96GZ6-7 ]
NP_001157947.1. NM_001164475.1. [Q96GZ6-8 ]
XP_005247618.1. XM_005247561.1. [Q96GZ6-1 ]
XP_005247619.1. XM_005247562.1. [Q96GZ6-1 ]
XP_005247620.1. XM_005247563.1. [Q96GZ6-1 ]
XP_006713744.1. XM_006713681.1. [Q96GZ6-1 ]
UniGenei Hs.573007.

3D structure databases

ProteinModelPortali Q96GZ6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120285. 4 interactions.
IntActi Q96GZ6. 2 interactions.
MINTi MINT-4933371.

Protein family/group databases

TCDBi 1.A.26.2.3. the mg(2+) transporter-e (mgte) family.

PTM databases

PhosphoSitei Q96GZ6.

Polymorphism databases

DMDMi 313104184.

Proteomic databases

MaxQBi Q96GZ6.
PaxDbi Q96GZ6.
PRIDEi Q96GZ6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000315891 ; ENSP00000326070 ; ENSG00000114544 . [Q96GZ6-1 ]
ENST00000346785 ; ENSP00000264471 ; ENSG00000114544 . [Q96GZ6-3 ]
ENST00000360370 ; ENSP00000353533 ; ENSG00000114544 . [Q96GZ6-9 ]
ENST00000383598 ; ENSP00000373092 ; ENSG00000114544 . [Q96GZ6-7 ]
ENST00000508835 ; ENSP00000427409 ; ENSG00000114544 . [Q96GZ6-8 ]
ENST00000612940 ; ENSP00000480188 ; ENSG00000114544 . [Q96GZ6-2 ]
GeneIDi 54946.
KEGGi hsa:54946.
UCSCi uc003eii.3. human. [Q96GZ6-7 ]
uc003eij.3. human. [Q96GZ6-1 ]
uc011bkh.2. human. [Q96GZ6-8 ]

Organism-specific databases

CTDi 54946.
GeneCardsi GC03M125725.
HGNCi HGNC:31046. SLC41A3.
HPAi HPA045847.
MIMi 610803. gene.
neXtProti NX_Q96GZ6.
PharmGKBi PA134878151.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1824.
GeneTreei ENSGT00390000016816.
HOGENOMi HOG000007017.
HOVERGENi HBG057187.
InParanoidi Q96GZ6.
KOi K15122.
OMAi TFCSSEI.
PhylomeDBi Q96GZ6.
TreeFami TF313647.

Miscellaneous databases

GeneWikii SLC41A3.
GenomeRNAii 54946.
NextBioi 35499673.
PROi Q96GZ6.
SOURCEi Search...

Gene expression databases

Bgeei Q96GZ6.
CleanExi HS_SLC41A3.
ExpressionAtlasi Q96GZ6. baseline and differential.
Genevestigatori Q96GZ6.

Family and domain databases

Gene3Di 1.10.357.20. 2 hits.
InterProi IPR006667. SLC41_membr_dom.
[Graphical view ]
Pfami PF01769. MgtE. 2 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6; 7 AND 8), VARIANTS ALA-62 AND MET-71.
    Tissue: Brain, Lung and Testis.
  2. "The DNA sequence, annotation and analysis of human chromosome 3."
    Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
    , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
    Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 9), VARIANT ALA-62.
    Tissue: Brain and Colon.

Entry informationi

Entry nameiS41A3_HUMAN
AccessioniPrimary (citable) accession number: Q96GZ6
Secondary accession number(s): A6ND60
, B3KSD9, B7Z4Y2, C9JE96, E7ENY4, Q8N342, Q8NB27, Q9H9I6, Q9HAB1, Q9NX30
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 30, 2010
Last modified: October 29, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3