Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96GZ6

- S41A3_HUMAN

UniProt

Q96GZ6 - S41A3_HUMAN

Protein

Solute carrier family 41 member 3

Gene

SLC41A3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 2 (30 Nov 2010)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Molecular functioni

    1. cation transmembrane transporter activity Source: InterPro

    Protein family/group databases

    TCDBi1.A.26.2.3. the mg(2+) transporter-e (mgte) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Solute carrier family 41 member 3
    Gene namesi
    Name:SLC41A3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 3

    Organism-specific databases

    HGNCiHGNC:31046. SLC41A3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: HPA

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134878151.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 507507Solute carrier family 41 member 3PRO_0000295592Add
    BLAST

    Proteomic databases

    MaxQBiQ96GZ6.
    PaxDbiQ96GZ6.
    PRIDEiQ96GZ6.

    PTM databases

    PhosphoSiteiQ96GZ6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96GZ6.
    BgeeiQ96GZ6.
    CleanExiHS_SLC41A3.
    GenevestigatoriQ96GZ6.

    Organism-specific databases

    HPAiHPA045847.

    Interactioni

    Protein-protein interaction databases

    BioGridi120285. 3 interactions.
    IntActiQ96GZ6. 2 interactions.
    MINTiMINT-4933371.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96GZ6.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei67 – 8721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei152 – 17221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei189 – 20921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei220 – 24021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei252 – 27221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei284 – 30421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei314 – 33421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei377 – 39721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei406 – 42621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei482 – 50221HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi378 – 3814Poly-Leu

    Sequence similaritiesi

    Belongs to the SLC41A transporter family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiCOG1824.
    HOGENOMiHOG000007017.
    HOVERGENiHBG057187.
    InParanoidiQ96GZ6.
    KOiK15122.
    OMAiTFCSSEI.
    PhylomeDBiQ96GZ6.
    TreeFamiTF313647.

    Family and domain databases

    Gene3Di1.10.357.20. 2 hits.
    InterProiIPR006667. SLC41_membr_dom.
    [Graphical view]
    PfamiPF01769. MgtE. 2 hits.
    [Graphical view]

    Sequences (9)i

    Sequence statusi: Complete.

    This entry describes 9 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96GZ6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDGTETRQRR LDSCGKPGEL GLPHPLSTGG LPVASEDGAL RAPESQSVTP    50
    KPLETEPSRE TTWSIGLQVT VPFMFAGLGL SWAGMLLDYF QHWPVFVEVK 100
    DLLTLVPPLV GLKGNLEMTL ASRLSTAANT GQIDDPQEQH RVISSNLALI 150
    QVQATVVGLL AAVAALLLGV VSREEVDVAK VELLCASSVL TAFLAAFALG 200
    VLMVCIVIGA RKLGVNPDNI ATPIAASLGD LITLSILALV SSFFYRHKDS 250
    RYLTPLVCLS FAALTPVWVL IAKQSPPIVK ILKFGWFPII LAMVISSFGG 300
    LILSKTVSKQ QYKGMAIFTP VICGVGGNLV AIQTSRISTY LHMWSAPGVL 350
    PLQMKKFWPN PCSTFCTSEI NSMSARVLLL LVVPGHLIFF YIIYLVEGQS 400
    VINSQTFVVL YLLAGLIQVT ILLYLAEVMV RLTWHQALDP DNHCIPYLTG 450
    LGDLLGSSSV GHTAAVPRRC TASPGWGLIQ PFICTQHLIV SLLSFYFPFC 500
    LLAKTSI 507
    Length:507
    Mass (Da):54,767
    Last modified:November 30, 2010 - v2
    Checksum:iEA2C1C9216F01AA1
    GO
    Isoform 2 (identifier: Q96GZ6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         501-507: Missing.

    Show »
    Length:500
    Mass (Da):54,040
    Checksum:i01EE7EF739103D9A
    GO
    Isoform 3 (identifier: Q96GZ6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         92-127: Missing.

    Show »
    Length:471
    Mass (Da):50,839
    Checksum:i077454E8023458E1
    GO
    Isoform 4 (identifier: Q96GZ6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         92-127: Missing.
         501-507: Missing.

    Show »
    Length:464
    Mass (Da):50,112
    Checksum:i014C542234BD1E66
    GO
    Isoform 5 (identifier: Q96GZ6-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         61-69: Missing.
         457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

    Show »
    Length:478
    Mass (Da):51,493
    Checksum:i073256C0E3E0035D
    GO
    Isoform 6 (identifier: Q96GZ6-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         218-266: Missing.
         457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

    Show »
    Length:438
    Mass (Da):47,200
    Checksum:iB5C3D56EE1863859
    GO
    Isoform 7 (identifier: Q96GZ6-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-26: Missing.
         27-90: STGGLPVASE...SWAGMLLDYF → MVVTQLNLEF...MTAGLVMNTI
         457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

    Show »
    Length:461
    Mass (Da):49,916
    Checksum:iDB62D800839C29A0
    GO
    Isoform 8 (identifier: Q96GZ6-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-117: Missing.
         457-507: SSSVGHTAAV...PFCLLAKTSI → TGLLALCFFTDWLLKSKAELGGISELASGPP

    Note: No experimental confirmation available.

    Show »
    Length:370
    Mass (Da):39,828
    Checksum:i8FC413D1A828CB95
    GO
    Isoform 9 (identifier: Q96GZ6-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         457-487: SSSVGHTAAVPRRCTASPGWGLIQPFICTQH → TGLLALCFFTDWLLKSKAELGGISELASGPP
         488-507: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:487
    Mass (Da):52,479
    Checksum:i33C81692DC272150
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti331 – 3311A → G in BAC03717. (PubMed:14702039)Curated
    Sequence conflicti387 – 3871L → P in BAB13938. (PubMed:14702039)Curated
    Sequence conflicti405 – 4051Q → R in BAC03717. (PubMed:14702039)Curated
    Sequence conflicti448 – 4481L → P in BAB13938. (PubMed:14702039)Curated
    Isoform 7 (identifier: Q96GZ6-7)
    Sequence conflicti432 – 4321G → S in BAG52701. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti62 – 621T → A.2 Publications
    Corresponds to variant rs4234270 [ dbSNP | Ensembl ].
    VAR_033296
    Natural varianti71 – 711V → M.1 Publication
    Corresponds to variant rs11543283 [ dbSNP | Ensembl ].
    VAR_046667

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 117117Missing in isoform 8. 1 PublicationVSP_043676Add
    BLAST
    Alternative sequencei1 – 2626Missing in isoform 7. 1 PublicationVSP_035505Add
    BLAST
    Alternative sequencei27 – 9064STGGL…LLDYF → MVVTQLNLEFCFQGKKLRGF SCELTRSPHGVLPESFFTIM CQVVVPILLSGLCMMTAGLV MNTI in isoform 7. 1 PublicationVSP_035506Add
    BLAST
    Alternative sequencei61 – 699Missing in isoform 5. 1 PublicationVSP_026934
    Alternative sequencei92 – 12736Missing in isoform 3 and isoform 4. 1 PublicationVSP_026935Add
    BLAST
    Alternative sequencei218 – 26649Missing in isoform 6. 1 PublicationVSP_026936Add
    BLAST
    Alternative sequencei457 – 50751SSSVG…AKTSI → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 5, isoform 6, isoform 7 and isoform 8. 1 PublicationVSP_026937Add
    BLAST
    Alternative sequencei457 – 48731SSSVG…ICTQH → TGLLALCFFTDWLLKSKAEL GGISELASGPP in isoform 9. 1 PublicationVSP_054059Add
    BLAST
    Alternative sequencei488 – 50720Missing in isoform 9. 1 PublicationVSP_054060Add
    BLAST
    Alternative sequencei501 – 5077Missing in isoform 2 and isoform 4. 2 PublicationsVSP_026938

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000480 mRNA. Translation: BAA91192.1.
    AK021925 mRNA. Translation: BAB13938.1.
    AK022780 mRNA. Translation: BAB14241.1.
    AK091671 mRNA. Translation: BAC03717.1.
    AK093380 mRNA. Translation: BAG52701.1.
    AK298070 mRNA. Translation: BAH12718.1.
    AC079848 Genomic DNA. No translation available.
    AC092903 Genomic DNA. No translation available.
    AC117422 Genomic DNA. No translation available.
    BC009444 mRNA. No translation available.
    BC009039 mRNA. Translation: AAH09039.1.
    BC028241 mRNA. Translation: AAH28241.1.
    CCDSiCCDS33842.1. [Q96GZ6-3]
    CCDS33843.1. [Q96GZ6-1]
    CCDS33844.1. [Q96GZ6-7]
    CCDS43144.1. [Q96GZ6-9]
    CCDS54635.1. [Q96GZ6-8]
    RefSeqiNP_001008485.1. NM_001008485.1.
    NP_001008486.1. NM_001008486.1.
    NP_001008487.1. NM_001008487.1. [Q96GZ6-7]
    NP_001157947.1. NM_001164475.1. [Q96GZ6-8]
    XP_005247618.1. XM_005247561.1. [Q96GZ6-1]
    XP_005247619.1. XM_005247562.1. [Q96GZ6-1]
    XP_005247620.1. XM_005247563.1. [Q96GZ6-1]
    XP_006713744.1. XM_006713681.1. [Q96GZ6-1]
    UniGeneiHs.573007.

    Genome annotation databases

    EnsembliENST00000315891; ENSP00000326070; ENSG00000114544. [Q96GZ6-1]
    ENST00000346785; ENSP00000264471; ENSG00000114544. [Q96GZ6-3]
    ENST00000360370; ENSP00000353533; ENSG00000114544. [Q96GZ6-9]
    ENST00000383598; ENSP00000373092; ENSG00000114544. [Q96GZ6-7]
    ENST00000508835; ENSP00000427409; ENSG00000114544. [Q96GZ6-8]
    GeneIDi54946.
    KEGGihsa:54946.
    UCSCiuc003eii.3. human. [Q96GZ6-7]
    uc003eij.3. human. [Q96GZ6-1]
    uc011bkh.2. human. [Q96GZ6-8]

    Polymorphism databases

    DMDMi313104184.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000480 mRNA. Translation: BAA91192.1 .
    AK021925 mRNA. Translation: BAB13938.1 .
    AK022780 mRNA. Translation: BAB14241.1 .
    AK091671 mRNA. Translation: BAC03717.1 .
    AK093380 mRNA. Translation: BAG52701.1 .
    AK298070 mRNA. Translation: BAH12718.1 .
    AC079848 Genomic DNA. No translation available.
    AC092903 Genomic DNA. No translation available.
    AC117422 Genomic DNA. No translation available.
    BC009444 mRNA. No translation available.
    BC009039 mRNA. Translation: AAH09039.1 .
    BC028241 mRNA. Translation: AAH28241.1 .
    CCDSi CCDS33842.1. [Q96GZ6-3 ]
    CCDS33843.1. [Q96GZ6-1 ]
    CCDS33844.1. [Q96GZ6-7 ]
    CCDS43144.1. [Q96GZ6-9 ]
    CCDS54635.1. [Q96GZ6-8 ]
    RefSeqi NP_001008485.1. NM_001008485.1.
    NP_001008486.1. NM_001008486.1.
    NP_001008487.1. NM_001008487.1. [Q96GZ6-7 ]
    NP_001157947.1. NM_001164475.1. [Q96GZ6-8 ]
    XP_005247618.1. XM_005247561.1. [Q96GZ6-1 ]
    XP_005247619.1. XM_005247562.1. [Q96GZ6-1 ]
    XP_005247620.1. XM_005247563.1. [Q96GZ6-1 ]
    XP_006713744.1. XM_006713681.1. [Q96GZ6-1 ]
    UniGenei Hs.573007.

    3D structure databases

    ProteinModelPortali Q96GZ6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120285. 3 interactions.
    IntActi Q96GZ6. 2 interactions.
    MINTi MINT-4933371.

    Protein family/group databases

    TCDBi 1.A.26.2.3. the mg(2+) transporter-e (mgte) family.

    PTM databases

    PhosphoSitei Q96GZ6.

    Polymorphism databases

    DMDMi 313104184.

    Proteomic databases

    MaxQBi Q96GZ6.
    PaxDbi Q96GZ6.
    PRIDEi Q96GZ6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000315891 ; ENSP00000326070 ; ENSG00000114544 . [Q96GZ6-1 ]
    ENST00000346785 ; ENSP00000264471 ; ENSG00000114544 . [Q96GZ6-3 ]
    ENST00000360370 ; ENSP00000353533 ; ENSG00000114544 . [Q96GZ6-9 ]
    ENST00000383598 ; ENSP00000373092 ; ENSG00000114544 . [Q96GZ6-7 ]
    ENST00000508835 ; ENSP00000427409 ; ENSG00000114544 . [Q96GZ6-8 ]
    GeneIDi 54946.
    KEGGi hsa:54946.
    UCSCi uc003eii.3. human. [Q96GZ6-7 ]
    uc003eij.3. human. [Q96GZ6-1 ]
    uc011bkh.2. human. [Q96GZ6-8 ]

    Organism-specific databases

    CTDi 54946.
    GeneCardsi GC03M125725.
    HGNCi HGNC:31046. SLC41A3.
    HPAi HPA045847.
    MIMi 610803. gene.
    neXtProti NX_Q96GZ6.
    PharmGKBi PA134878151.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG1824.
    HOGENOMi HOG000007017.
    HOVERGENi HBG057187.
    InParanoidi Q96GZ6.
    KOi K15122.
    OMAi TFCSSEI.
    PhylomeDBi Q96GZ6.
    TreeFami TF313647.

    Miscellaneous databases

    GeneWikii SLC41A3.
    GenomeRNAii 54946.
    NextBioi 35499673.
    PROi Q96GZ6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96GZ6.
    Bgeei Q96GZ6.
    CleanExi HS_SLC41A3.
    Genevestigatori Q96GZ6.

    Family and domain databases

    Gene3Di 1.10.357.20. 2 hits.
    InterProi IPR006667. SLC41_membr_dom.
    [Graphical view ]
    Pfami PF01769. MgtE. 2 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3; 4; 5; 6; 7 AND 8), VARIANTS ALA-62 AND MET-71.
      Tissue: Brain, Lung and Testis.
    2. "The DNA sequence, annotation and analysis of human chromosome 3."
      Muzny D.M., Scherer S.E., Kaul R., Wang J., Yu J., Sudbrak R., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J.
      , Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R., Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Wei S., Wheeler D.A., Wright M.W., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clendenning J., Clerc-Blankenburg K.P., Chen R., Chen Z., Davis C., Delgado O., Dinh H.H., Dong W., Draper H., Ernst S., Fu G., Gonzalez-Garay M.L., Garcia D.K., Gillett W., Gu J., Hao B., Haugen E., Havlak P., He X., Hennig S., Hu S., Huang W., Jackson L.R., Jacob L.S., Kelly S.H., Kube M., Levy R., Li Z., Liu B., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Palmeiri A., Pasternak S., Perez L.M., Phelps K.A., Plopper F.J., Qiang B., Raymond C., Rodriguez R., Saenphimmachak C., Santibanez J., Shen H., Shen Y., Subramanian S., Tabor P.E., Verduzco D., Waldron L., Wang J., Wang J., Wang Q., Williams G.A., Wong G.K.-S., Yao Z., Zhang J., Zhang X., Zhao G., Zhou J., Zhou Y., Nelson D., Lehrach H., Reinhardt R., Naylor S.L., Yang H., Olson M., Weinstock G., Gibbs R.A.
      Nature 440:1194-1198(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 9), VARIANT ALA-62.
      Tissue: Brain and Colon.

    Entry informationi

    Entry nameiS41A3_HUMAN
    AccessioniPrimary (citable) accession number: Q96GZ6
    Secondary accession number(s): A6ND60
    , B3KSD9, B7Z4Y2, C9JE96, E7ENY4, Q8N342, Q8NB27, Q9H9I6, Q9HAB1, Q9NX30
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 24, 2007
    Last sequence update: November 30, 2010
    Last modified: October 1, 2014
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 3
      Human chromosome 3: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3