Q96GX9 (MTNB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Methylthioribulose-1-phosphate dehydratase Short name=MTRu-1-P dehydratase EC=4.2.1.109 Alternative name(s): APAF1-interacting protein Short name=hAPIP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 242 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway, which plays a key role in cancer, apoptosis, microbial proliferation and inflammation. May inhibit the CASP1-related inflammatory response (pyroptosis), the CASP9-dependent apoptotic pathway and the cytochrome c-dependent and APAF1-mediated cell death. Ref.5 Ref.8 Ref.9 |
| Catalytic activity | S-methyl-5-thio-D-ribulose 1-phosphate = 5-(methylthio)-2,3-dioxopentyl phosphate + H2O. HAMAP-Rule MF_03116 |
| Cofactor | Binds 1 zinc ion per subunit By similarity. |
| Pathway | Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 2/6. Ref.8 |
| Subunit structure | |
| Subcellular location | |
| Tissue specificity | Isoform 1 is ubiquitously expressed. Isoform 2 is expressed at lower levels and detected in heart, brain, pancreas, liver, placenta, skeletal muscle and kidney. Ref.5 Ref.8 |
| Sequence similarities | Belongs to the aldolase class II family. MtnB subfamily. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| itself | 4 | EBI-359248,EBI-359248 | ||
| NUDT18 | Q6ZVK8 | 3 | EBI-359248,EBI-740486 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96GX9-1) Also known as: Long; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96GX9-3) Also known as: Short; The sequence of this isoform differs from the canonical sequence as follows: 1-53: MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHG → MLGRETVVPGDAARS |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 242 | 242 | Methylthioribulose-1-phosphate dehydratase HAMAP-Rule MF_03116 | PRO_0000239022 | |||||
Sites | |||||||||
| Metal binding | 115 | 1 | Zinc Probable | ||||||
| Metal binding | 117 | 1 | Zinc Probable | ||||||
Amino acid modifications | |||||||||
| Modified residue | 87 | 1 | Phosphoserine Ref.7 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 53 | 53 | MSGCD…SLKHG → MLGRETVVPGDAARS in isoform 2. | VSP_044403 | |||||
| Natural variant | 7 | 1 | R → W. Ref.2 Ref.4 Corresponds to variant rs2956114 [ dbSNP | Ensembl ]. | VAR_026575 | |||||
| Natural variant | 23 | 1 | H → R. Ref.4 Corresponds to variant rs17850326 [ dbSNP | Ensembl ]. | VAR_026576 | |||||
| Natural variant | 76 | 1 | C → Y. Ref.2 Ref.4 Corresponds to variant rs1977420 [ dbSNP | Ensembl ]. | VAR_026577 | |||||
| Natural variant | 181 | 1 | M → V. Ref.4 Corresponds to variant rs17850327 [ dbSNP | Ensembl ]. | VAR_026578 | |||||
Experimental info | |||||||||
| Mutagenesis | 84 | 1 | S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-87 and A,D-89. Ref.8 | ||||||
| Mutagenesis | 87 | 1 | S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-89. Ref.8 | ||||||
| Mutagenesis | 89 | 1 | S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-87. Ref.8 | ||||||
| Mutagenesis | 97 | 1 | C → A: Acts as a dominant negative mutant; unable to use 5'-methylthioadenosine as source of methionine. Does not affect the ability to bind CASP1 and to inhibit cell death induced by CASP9 overexpression. Ref.9 | ||||||
| Mutagenesis | 115 | 1 | H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-117 and A-195. Unable to inhibit both CASP1 and CASP9 mediated cell death. Ref.8 Ref.9 | ||||||
| Mutagenesis | 117 | 1 | H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-115 and A-195. Ref.8 | ||||||
| Mutagenesis | 195 | 1 | H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with 87-A--A-89. Ref.8 | ||||||
| Sequence conflict | 7 | 1 | R → G in AAD27738. Ref.1 | ||||||
| Sequence conflict | 172 | 1 | D → T in AAD27738. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics." Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C. Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS TRP-7 AND TYR-76. Tissue: Thymus. |
| [3] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS TRP-7; ARG-23; TYR-76 AND VAL-181. Tissue: Bone marrow, Colon and Eye. |
| [5] | "Induced inhibition of ischemic/hypoxic injury by APIP, a novel Apaf-1-interacting protein." Cho D.-H., Hong Y.-M., Lee H.-J., Woo H.-N., Pyo J.-O., Mak T.W., Jung Y.-K. J. Biol. Chem. 279:39942-39950(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH APAF1, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING (ISOFORM 2). |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-87, MASS SPECTROMETRY. |
| [8] | "Functional identification of APIP as human mtnB, a key enzyme in the methionine salvage pathway." Mary C., Duek P., Salleron L., Tienz P., Bumann D., Bairoch A., Lane L. PLoS ONE 7:E52877-E52877(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, PATHWAY, ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF SER-84; SER-87; SER-89; HIS-115; HIS-117 AND HIS-195. |
| [9] | "Functional genetic screen of human diversity reveals that a methionine salvage enzyme regulates inflammatory cell death." Ko D.C., Gamazon E.R., Shukla K.P., Pfuetzner R.A., Whittington D., Holden T.D., Brittnacher M.J., Fong C., Radey M., Ogohara C., Stark A.L., Akey J.M., Dolan M.E., Wurfel M.M., Miller S.I. Proc. Natl. Acad. Sci. U.S.A. 109:E2343-E2352(2012) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CASP1, MUTAGENESIS OF CYS-97 AND HIS-115. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF132963 mRNA. Translation: AAD27738.1. AK292648 mRNA. Translation: BAF85337.1. AC107928 Genomic DNA. No translation available. BC008440 mRNA. Translation: AAH08440.1. BC009077 mRNA. Translation: AAH09077.1. BC017594 mRNA. Translation: AAH17594.1. |
| IPI | IPI00549730. |
| RefSeq | NP_057041.2. NM_015957.2. |
| UniGene | Hs.447794. |
3D structure databases | |
| ProteinModelPortal | Q96GX9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96GX9. 14 interactions. |
| MINT | MINT-1156691. |
| STRING | 9606.ENSP00000278359. |
PTM databases | |
| PhosphoSite | Q96GX9. |
Polymorphism databases | |
| DMDM | 74731866. |
Proteomic databases | |
| PaxDb | Q96GX9. |
| PeptideAtlas | Q96GX9. |
| PRIDE | Q96GX9. |
Protocols and materials databases | |
| DNASU | 51074. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000395787; ENSP00000379133; ENSG00000149089. |
| GeneID | 51074. |
| KEGG | hsa:51074. |
| UCSC | uc001mvs.2. human. |
Organism-specific databases | |
| CTD | 51074. |
| GeneCards | GC11M034861. |
| HGNC | HGNC:17581. APIP. |
| HPA | HPA021188. HPA024131. |
| MIM | 612491. gene. |
| neXtProt | NX_Q96GX9. |
| PharmGKB | PA142672601. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0235. |
| HOGENOM | HOG000192424. |
| HOVERGEN | HBG080536. |
| InParanoid | Q96GX9. |
| KO | K08964. |
| OrthoDB | EOG4ZCT5D. |
| PhylomeDB | Q96GX9. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. |
| UniPathway | UPA00904; UER00875. |
Gene expression databases | |
| Bgee | Q96GX9. |
| CleanEx | HS_APIP. |
| Genevestigator | Q96GX9. |
| GermOnline | ENSG00000149089. Homo sapiens. |
Family and domain databases | |
| Gene3D | 3.40.225.10. 1 hit. |
| HAMAP | MF_03116. Salvage_MtnB_euk. |
| InterPro | IPR001303. Aldolase_II/adducin_N. IPR017714. MethylthioRu-1-P_deHdtase_MtnB. [Graphical view] |
| PANTHER | PTHR10640. PTHR10640. 1 hit. |
| Pfam | PF00596. Aldolase_II. 1 hit. [Graphical view] |
| SMART | SM01007. Aldolase_II. 1 hit. [Graphical view] |
| SUPFAM | SSF53639. Aldolase_II_N. 1 hit. |
| TIGRFAMs | TIGR03328. salvage_mtnB. 1 hit. |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 51074. |
| NextBio | 53699. |
| SOURCE | Search... |
Entry information
| Entry name | MTNB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96GX9 Secondary accession number(s): A8K9D3 Q9Y318 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
