Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96GX9

- MTNB_HUMAN

UniProt

Q96GX9 - MTNB_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Methylthioribulose-1-phosphate dehydratase

Gene

APIP

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway, which plays a key role in cancer, apoptosis, microbial proliferation and inflammation. May inhibit the CASP1-related inflammatory response (pyroptosis), the CASP9-dependent apoptotic pathway and the cytochrome c-dependent and APAF1-mediated cell death.3 PublicationsUniRule annotation

Catalytic activityi

S-methyl-5-thio-D-ribulose 1-phosphate = 5-(methylthio)-2,3-dioxopentyl phosphate + H2O.UniRule annotation

Cofactori

Zn2+UniRule annotationNote: Binds 1 zinc ion per subunit.UniRule annotation

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi115 – 1151ZincCurated
Metal bindingi117 – 1171ZincCurated

GO - Molecular functioni

  1. identical protein binding Source: IntAct
  2. methylthioribulose 1-phosphate dehydratase activity Source: Reactome
  3. zinc ion binding Source: UniProtKB-HAMAP

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cellular nitrogen compound metabolic process Source: Reactome
  3. L-methionine biosynthetic process from methylthioadenosine Source: UniProtKB
  4. L-methionine biosynthetic process from S-adenosylmethionine Source: UniProtKB-HAMAP
  5. negative regulation of apoptotic process Source: UniProtKB
  6. polyamine metabolic process Source: Reactome
  7. regulation of ERK1 and ERK2 cascade Source: UniProtKB
  8. small molecule metabolic process Source: Reactome
  9. sulfur amino acid metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Lyase

Keywords - Biological processi

Amino-acid biosynthesis, Apoptosis, Methionine biosynthesis

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_75881. Methionine salvage pathway.
UniPathwayiUPA00904; UER00875.

Names & Taxonomyi

Protein namesi
Recommended name:
Methylthioribulose-1-phosphate dehydrataseUniRule annotation (EC:4.2.1.109UniRule annotation)
Short name:
MTRu-1-P dehydrataseUniRule annotation
Alternative name(s):
APAF1-interacting proteinUniRule annotation
Short name:
hAPIP
Gene namesi
Name:APIPUniRule annotation
ORF Names:CGI-29
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:17581. APIP.

Subcellular locationi

Cytoplasm 2 PublicationsUniRule annotation

GO - Cellular componenti

  1. cytosol Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi84 – 841S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-87 and A,D-89. 1 Publication
Mutagenesisi87 – 871S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-89. 1 Publication
Mutagenesisi89 – 891S → A or D: Does not affect ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A,D-84 and A,D-87. 1 Publication
Mutagenesisi97 – 971C → A: Acts as a dominant negative mutant; unable to use 5'-methylthioadenosine as source of methionine. Does not affect the ability to bind CASP1 and to inhibit cell death induced by CASP9 overexpression. 1 Publication
Mutagenesisi115 – 1151H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-117 and A-195. Unable to inhibit both CASP1 and CASP9 mediated cell death. 2 Publications
Mutagenesisi117 – 1171H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with A-115 and A-195. 1 Publication
Mutagenesisi195 – 1951H → A: Impaired ability of cells to grow in media where methionine is replaced by 5-methylthioadenosine; when associated with 87-A--A-89. 1 Publication

Organism-specific databases

PharmGKBiPA142672601.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 242242Methylthioribulose-1-phosphate dehydratasePRO_0000239022Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei87 – 871Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96GX9.
PaxDbiQ96GX9.
PeptideAtlasiQ96GX9.
PRIDEiQ96GX9.

PTM databases

PhosphoSiteiQ96GX9.

Expressioni

Tissue specificityi

Isoform 1 is ubiquitously expressed. Isoform 2 is expressed at lower levels and detected in heart, brain, pancreas, liver, placenta, skeletal muscle and kidney.2 Publications

Gene expression databases

BgeeiQ96GX9.
CleanExiHS_APIP.
ExpressionAtlasiQ96GX9. baseline.
GenevestigatoriQ96GX9.

Organism-specific databases

HPAiHPA021188.
HPA024131.

Interactioni

Subunit structurei

Interacts with APAF1. May interact with CASP1.2 PublicationsUniRule annotation

Binary interactionsi

WithEntry#Exp.IntActNotes
itself4EBI-359248,EBI-359248
NUDT18Q6ZVK83EBI-359248,EBI-740486

Protein-protein interaction databases

BioGridi119265. 18 interactions.
IntActiQ96GX9. 14 interactions.
MINTiMINT-1156691.
STRINGi9606.ENSP00000278359.

Structurei

Secondary structure

1
242
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi24 – 3714Combined sources
Helixi42 – 443Combined sources
Beta strandi47 – 526Combined sources
Beta strandi55 – 584Combined sources
Helixi65 – 673Combined sources
Helixi70 – 723Combined sources
Beta strandi74 – 763Combined sources
Beta strandi82 – 843Combined sources
Helixi88 – 903Combined sources
Helixi98 – 10811Combined sources
Beta strandi111 – 1166Combined sources
Helixi119 – 1279Combined sources
Beta strandi130 – 1378Combined sources
Helixi139 – 1435Combined sources
Turni147 – 1493Combined sources
Beta strandi157 – 1648Combined sources
Helixi170 – 18314Combined sources
Beta strandi188 – 1925Combined sources
Turni193 – 1953Combined sources
Beta strandi196 – 2038Combined sources
Helixi204 – 22623Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4M6RX-ray2.00A/B/C/D20-242[»]
ProteinModelPortaliQ96GX9.
SMRiQ96GX9. Positions 20-242.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the aldolase class II family. MtnB subfamily.UniRule annotation

Phylogenomic databases

eggNOGiCOG0235.
GeneTreeiENSGT00390000001680.
HOGENOMiHOG000192424.
HOVERGENiHBG080536.
InParanoidiQ96GX9.
KOiK08964.
OrthoDBiEOG74TX0H.
PhylomeDBiQ96GX9.
TreeFamiTF105632.

Family and domain databases

Gene3Di3.40.225.10. 1 hit.
HAMAPiMF_03116. Salvage_MtnB_euk.
InterProiIPR001303. Aldolase_II/adducin_N.
IPR017714. MethylthioRu-1-P_deHdtase_MtnB.
IPR027514. Salvage_MtnB_euk.
[Graphical view]
PANTHERiPTHR10640. PTHR10640. 1 hit.
PfamiPF00596. Aldolase_II. 1 hit.
[Graphical view]
SMARTiSM01007. Aldolase_II. 1 hit.
[Graphical view]
SUPFAMiSSF53639. SSF53639. 1 hit.
TIGRFAMsiTIGR03328. salvage_mtnB. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96GX9-1) [UniParc]FASTAAdd to Basket

Also known as: Long

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGCDAREGD CCSRRCGAQD KEHPRYLIPE LCKQFYHLGW VTGTGGGISL
60 70 80 90 100
KHGDEIYIAP SGVQKERIQP EDMFVCDINE KDISGPSPSK KLKKSQCTPL
110 120 130 140 150
FMNAYTMRGA GAVIHTHSKA AVMATLLFPG REFKITHQEM IKGIKKCTSG
160 170 180 190 200
GYYRYDDMLV VPIIENTPEE KDLKDRMAHA MNEYPDSCAV LVRRHGVYVW
210 220 230 240
GETWEKAKTM CECYDYLFDI AVSMKKVGLD PSQLPVGENG IV
Length:242
Mass (Da):27,125
Last modified:December 1, 2001 - v1
Checksum:i9B8D5D1435D6775A
GO
Isoform 2 (identifier: Q96GX9-3) [UniParc]FASTAAdd to Basket

Also known as: Short

The sequence of this isoform differs from the canonical sequence as follows:
     1-53: MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHG → MLGRETVVPGDAARS

Show »
Length:204
Mass (Da):22,858
Checksum:i82FC4E97BC6C2853
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti7 – 71R → G in AAD27738. (PubMed:10810093)Curated
Sequence conflicti172 – 1721D → T in AAD27738. (PubMed:10810093)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti7 – 71R → W.2 Publications
Corresponds to variant rs2956114 [ dbSNP | Ensembl ].
VAR_026575
Natural varianti23 – 231H → R.1 Publication
Corresponds to variant rs17850326 [ dbSNP | Ensembl ].
VAR_026576
Natural varianti76 – 761C → Y.2 Publications
Corresponds to variant rs1977420 [ dbSNP | Ensembl ].
VAR_026577
Natural varianti181 – 1811M → V.1 Publication
Corresponds to variant rs17850327 [ dbSNP | Ensembl ].
VAR_026578

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5353MSGCD…SLKHG → MLGRETVVPGDAARS in isoform 2. CuratedVSP_044403Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132963 mRNA. Translation: AAD27738.1.
AK292648 mRNA. Translation: BAF85337.1.
AC107928 Genomic DNA. No translation available.
BC008440 mRNA. Translation: AAH08440.1.
BC009077 mRNA. Translation: AAH09077.1.
BC017594 mRNA. Translation: AAH17594.1.
CCDSiCCDS7895.1. [Q96GX9-1]
RefSeqiNP_057041.2. NM_015957.3. [Q96GX9-1]
UniGeneiHs.447794.

Genome annotation databases

EnsembliENST00000395787; ENSP00000379133; ENSG00000149089. [Q96GX9-1]
GeneIDi51074.
KEGGihsa:51074.
UCSCiuc001mvs.2. human. [Q96GX9-1]

Polymorphism databases

DMDMi74731866.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF132963 mRNA. Translation: AAD27738.1 .
AK292648 mRNA. Translation: BAF85337.1 .
AC107928 Genomic DNA. No translation available.
BC008440 mRNA. Translation: AAH08440.1 .
BC009077 mRNA. Translation: AAH09077.1 .
BC017594 mRNA. Translation: AAH17594.1 .
CCDSi CCDS7895.1. [Q96GX9-1 ]
RefSeqi NP_057041.2. NM_015957.3. [Q96GX9-1 ]
UniGenei Hs.447794.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
4M6R X-ray 2.00 A/B/C/D 20-242 [» ]
ProteinModelPortali Q96GX9.
SMRi Q96GX9. Positions 20-242.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119265. 18 interactions.
IntActi Q96GX9. 14 interactions.
MINTi MINT-1156691.
STRINGi 9606.ENSP00000278359.

PTM databases

PhosphoSitei Q96GX9.

Polymorphism databases

DMDMi 74731866.

Proteomic databases

MaxQBi Q96GX9.
PaxDbi Q96GX9.
PeptideAtlasi Q96GX9.
PRIDEi Q96GX9.

Protocols and materials databases

DNASUi 51074.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000395787 ; ENSP00000379133 ; ENSG00000149089 . [Q96GX9-1 ]
GeneIDi 51074.
KEGGi hsa:51074.
UCSCi uc001mvs.2. human. [Q96GX9-1 ]

Organism-specific databases

CTDi 51074.
GeneCardsi GC11M034861.
HGNCi HGNC:17581. APIP.
HPAi HPA021188.
HPA024131.
MIMi 612491. gene.
neXtProti NX_Q96GX9.
PharmGKBi PA142672601.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0235.
GeneTreei ENSGT00390000001680.
HOGENOMi HOG000192424.
HOVERGENi HBG080536.
InParanoidi Q96GX9.
KOi K08964.
OrthoDBi EOG74TX0H.
PhylomeDBi Q96GX9.
TreeFami TF105632.

Enzyme and pathway databases

UniPathwayi UPA00904 ; UER00875 .
Reactomei REACT_75881. Methionine salvage pathway.

Miscellaneous databases

GeneWikii APIP.
GenomeRNAii 51074.
NextBioi 53699.
PROi Q96GX9.
SOURCEi Search...

Gene expression databases

Bgeei Q96GX9.
CleanExi HS_APIP.
ExpressionAtlasi Q96GX9. baseline.
Genevestigatori Q96GX9.

Family and domain databases

Gene3Di 3.40.225.10. 1 hit.
HAMAPi MF_03116. Salvage_MtnB_euk.
InterProi IPR001303. Aldolase_II/adducin_N.
IPR017714. MethylthioRu-1-P_deHdtase_MtnB.
IPR027514. Salvage_MtnB_euk.
[Graphical view ]
PANTHERi PTHR10640. PTHR10640. 1 hit.
Pfami PF00596. Aldolase_II. 1 hit.
[Graphical view ]
SMARTi SM01007. Aldolase_II. 1 hit.
[Graphical view ]
SUPFAMi SSF53639. SSF53639. 1 hit.
TIGRFAMsi TIGR03328. salvage_mtnB. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics."
    Lai C.-H., Chou C.-Y., Ch'ang L.-Y., Liu C.-S., Lin W.-C.
    Genome Res. 10:703-713(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS TRP-7 AND TYR-76.
    Tissue: Thymus.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANTS TRP-7; ARG-23; TYR-76 AND VAL-181.
    Tissue: Bone marrow, Colon and Eye.
  5. "Induced inhibition of ischemic/hypoxic injury by APIP, a novel Apaf-1-interacting protein."
    Cho D.-H., Hong Y.-M., Lee H.-J., Woo H.-N., Pyo J.-O., Mak T.W., Jung Y.-K.
    J. Biol. Chem. 279:39942-39950(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH APAF1, TISSUE SPECIFICITY, SUBCELLULAR LOCATION, ALTERNATIVE SPLICING (ISOFORM 2).
  6. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-87, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Functional identification of APIP as human mtnB, a key enzyme in the methionine salvage pathway."
    Mary C., Duek P., Salleron L., Tienz P., Bumann D., Bairoch A., Lane L.
    PLoS ONE 7:E52877-E52877(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, PATHWAY, ALTERNATIVE SPLICING (ISOFORM 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF SER-84; SER-87; SER-89; HIS-115; HIS-117 AND HIS-195.
  9. "Functional genetic screen of human diversity reveals that a methionine salvage enzyme regulates inflammatory cell death."
    Ko D.C., Gamazon E.R., Shukla K.P., Pfuetzner R.A., Whittington D., Holden T.D., Brittnacher M.J., Fong C., Radey M., Ogohara C., Stark A.L., Akey J.M., Dolan M.E., Wurfel M.M., Miller S.I.
    Proc. Natl. Acad. Sci. U.S.A. 109:E2343-E2352(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH CASP1, MUTAGENESIS OF CYS-97 AND HIS-115.

Entry informationi

Entry nameiMTNB_HUMAN
AccessioniPrimary (citable) accession number: Q96GX9
Secondary accession number(s): A8K9D3
, Q6PJX6, Q8WVU2, Q96HK2, Q9Y318
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 30, 2006
Last sequence update: December 1, 2001
Last modified: November 26, 2014
This is version 110 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3