Q96GS6 (F18A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 78.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Abhydrolase domain-containing protein FAM108A1 EC=3.-.-.- | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 310 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Secreted Potential. |
| Sequence similarities | Belongs to the AB hydrolase superfamily. FAM108 family. |
| Sequence caution | The sequence BAB15709.1 differs from that shown. Reason: Erroneous initiation. The sequence BAB84869.1 differs from that shown. Reason: Erroneous initiation. The sequence BAC03419.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Secreted |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal |
| Molecular function | Hydrolase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | extracellular region Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | hydrolase activity Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | |||||||||
| Isoform 1 (identifier: Q96GS6-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | |||||||||
| Isoform 2 (identifier: Q96GS6-2) The sequence of this isoform differs from the canonical sequence as follows: 109-109: G → GARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGKSWGTGAALACGYIHLL | |||||||||
Sequence annotation (Features) | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
| Sequence conflict | 144 | 1 | K → E in AAH20512. Ref.4 | ||||||
| Isoform 3 (identifier: Q96GS6-3) The sequence of this isoform differs from the canonical sequence as follows: 236-236: N → K 237-310: Missing. | |||||||||
| Isoform 4 (identifier: Q96GS6-4) The sequence of this isoform differs from the canonical sequence as follows: 177-310: Missing. | |||||||||
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 20 | 20 | Potential | ||||||
| Chain | 21 – 310 | 290 | Abhydrolase domain-containing protein FAM108A1 | PRO_0000297509 | |||||
Sites | |||||||||
| Active site | 190 | 1 | Charge relay system By similarity | ||||||
| Active site | 255 | 1 | Charge relay system By similarity | ||||||
| Active site | 284 | 1 | Charge relay system By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 109 | 1 | G → GARQGHQAQGGHPQLAWVGR LGDSNNPAPGGCLLGKSWGT GAALACGYIHLL in isoform 2. | VSP_027268 | |||||
| Alternative sequence | 177 – 310 | 134 | Missing in isoform 4. | VSP_027271 | |||||
| Alternative sequence | 236 | 1 | N → K in isoform 3. | VSP_027269 | |||||
| Alternative sequence | 237 – 310 | 74 | Missing in isoform 3. | VSP_027270 | |||||
Experimental info | |||||||||
| Sequence conflict | 98 | 1 | R → H in AAH00158. Ref.4 | ||||||
| Sequence conflict | 98 | 1 | R → H in AAH11667. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Cerebellum and Spleen. |
| [2] | "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries." Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. Isogai T.DNA Res. 12:117-126(2005) [PubMed: 16303743] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Embryo. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Brain, Cervix, Colon, Muscle, Ovary, Prostate and Skin. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK024419 mRNA. Translation: BAB15709.1. Different initiation. AK074043 mRNA. Translation: BAB84869.1. Different initiation. AK289533 mRNA. Translation: BAF82222.1. AK090438 mRNA. Translation: BAC03419.1. Different initiation. AK074548 mRNA. Translation: BAC11052.1. CH471139 Genomic DNA. Translation: EAW69441.1. CH471139 Genomic DNA. Translation: EAW69444.1. CH471139 Genomic DNA. Translation: EAW69446.1. BC000158 mRNA. Translation: AAH00158.1. BC009256 mRNA. Translation: AAH09256.1. BC011667 mRNA. Translation: AAH11667.1. BC020512 mRNA. Translation: AAH20512.1. BC033749 mRNA. Translation: AAH33749.1. BC035961 mRNA. Translation: AAH35961.1. BC071644 mRNA. Translation: AAH71644.1. BC071876 mRNA. Translation: AAH71876.1. BC094816 mRNA. Translation: AAH94816.1. |
| IPI | IPI00102923. IPI00643408. IPI00854784. IPI00854853. |
| RefSeq | NP_001123583.1. NM_001130111.1. NP_112490.3. NM_031213.3. |
| UniGene | Hs.465542. Hs.653679. |
3D structure databases | |
| ProteinModelPortal | Q96GS6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96GS6. 1 interaction. |
| STRING | Q96GS6. |
Protein family/group databases | |
| MEROPS | S09.052. |
PTM databases | |
| PhosphoSite | Q96GS6. |
Polymorphism databases | |
| DMDM | 74751891. |
Proteomic databases | |
| PRIDE | Q96GS6. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000292577; ENSP00000292577; ENSG00000129968. ENST00000454155; ENSP00000407632; ENSG00000129968. |
| GeneID | 81926. |
| KEGG | hsa:81926. |
| UCSC | uc001hkn.1. human. uc002luf.1. human. uc002lug.1. human. |
Organism-specific databases | |
| CTD | 81926. |
| GeneCards | GC19M001878. |
| H-InvDB | HIX0014598. HIX0060099. HIX0197203. HIX0200130. HIX0202559. |
| HGNC | HGNC:28756. FAM108A1. |
| neXtProt | NX_Q96GS6. |
| PharmGKB | PA134947443. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG09132. |
| GeneTree | ENSGT00390000000948. |
| HOGENOM | HBG678036. |
| HOVERGEN | HBG061270. |
| OrthoDB | EOG46MBK6. |
| PhylomeDB | Q96GS6. |
Gene expression databases | |
| Bgee | Q96GS6. |
| CleanEx | HS_FAM108A1. |
| Genevestigator | Q96GS6. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 72257. |
Entry information
| Entry name | F18A1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96GS6 Secondary accession number(s): A8K0G8 Q9H7Q9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| SIMILARITY comments Index of protein domains and families |

Clusters with