Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ABHD17A

Gene

ABHD17A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei190 – 1901Charge relay systemBy similarity
Active sitei255 – 2551Charge relay systemBy similarity
Active sitei284 – 2841Charge relay systemBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase

Protein family/group databases

ESTHERihuman-ABHD17A. 5_AlphaBeta_hydrolase.
MEROPSiS09.052.

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ABHD17ACurated (EC:3.-.-.-)
Alternative name(s):
Alpha/beta hydrolase domain-containing protein 17ACurated
Short name:
Abhydrolase domain-containing protein 17AImported
Gene namesi
Name:ABHD17AImported
Synonyms:C19orf27, FAM108A1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:28756. ABHD17A.

Subcellular locationi

GO - Cellular componenti

  • extracellular region Source: UniProtKB-SubCell
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134947443.

Polymorphism and mutation databases

BioMutaiABHD17A.
DMDMi74751891.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2020Sequence analysisAdd
BLAST
Chaini21 – 310290Protein ABHD17APRO_0000297509Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei302 – 3021PhosphoserineBy similarity
Modified residuei307 – 3071PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96GS6.
MaxQBiQ96GS6.
PeptideAtlasiQ96GS6.
PRIDEiQ96GS6.

PTM databases

iPTMnetiQ96GS6.
PhosphoSiteiQ96GS6.
SwissPalmiQ96GS6.

Expressioni

Gene expression databases

BgeeiENSG00000129968.
CleanExiHS_FAM108A1.
ExpressionAtlasiQ96GS6. baseline and differential.
GenevisibleiQ96GS6. HS.

Organism-specific databases

HPAiHPA043270.
HPA047226.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
Hoxa1P090223EBI-2870273,EBI-3957603From a different organism.
HPGDSO607603EBI-2870273,EBI-10187349

Protein-protein interaction databases

BioGridi123627. 19 interactions.
IntActiQ96GS6. 14 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ96GS6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the AB hydrolase superfamily. ABHD17 family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

GeneTreeiENSGT00390000000948.
HOVERGENiHBG061270.
InParanoidiQ96GS6.
OMAiACMYVRC.
OrthoDBiEOG091G0EV3.
PhylomeDBiQ96GS6.
TreeFamiTF314365.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR022742. Hydrolase_4.
[Graphical view]
PfamiPF12146. Hydrolase_4. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96GS6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNGLSLSELC CLFCCPPCPG RIAAKLAFLP PEATYSLVPE PEPGPGGAGA
60 70 80 90 100
APLGTLRASS GAPGRWKLHL TERADFQYSQ RELDTIEVFP TKSARGNRVS
110 120 130 140 150
CMYVRCVPGA RYTVLFSHGN AVDLGQMSSF YIGLGSRLHC NIFSYDYSGY
160 170 180 190 200
GASSGRPSER NLYADIDAAW QALRTRYGIS PDSIILYGQS IGTVPTVDLA
210 220 230 240 250
SRYECAAVVL HSPLTSGMRV AFPDTKKTYC FDAFPNIEKV SKITSPVLII
260 270 280 290 300
HGTEDEVIDF SHGLALYERC PKAVEPLWVE GAGHNDIELY SQYLERLRRF
310
ISQELPSQRA
Length:310
Mass (Da):33,990
Last modified:December 1, 2001 - v1
Checksum:i35FC521C6C245BA0
GO
Isoform 2 (identifier: Q96GS6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-109: G → GARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGKSWGTGAALACGYIHLL

Show »
Length:361
Mass (Da):39,136
Checksum:i0C7BD4C0C50C8792
GO
Isoform 3 (identifier: Q96GS6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-236: N → K
     237-310: Missing.

Show »
Length:236
Mass (Da):25,529
Checksum:iBB7B6CD4879BD95F
GO
Isoform 4 (identifier: Q96GS6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     177-310: Missing.

Show »
Length:176
Mass (Da):19,048
Checksum:i2E606EF6126C01C7
GO

Sequence cautioni

The sequence BAB15709 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAB84869 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC03419 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti98 – 981R → H in AAH00158 (PubMed:15489334).Curated
Sequence conflicti98 – 981R → H in AAH11667 (PubMed:15489334).Curated
Isoform 2 (identifier: Q96GS6-2)
Sequence conflicti144 – 1441K → E in AAH20512 (PubMed:15489334).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei109 – 1091G → GARQGHQAQGGHPQLAWVGR LGDSNNPAPGGCLLGKSWGT GAALACGYIHLL in isoform 2. 1 PublicationVSP_027268
Alternative sequencei177 – 310134Missing in isoform 4. 1 PublicationVSP_027271Add
BLAST
Alternative sequencei236 – 2361N → K in isoform 3. 1 PublicationVSP_027269
Alternative sequencei237 – 31074Missing in isoform 3. 1 PublicationVSP_027270Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024419 mRNA. Translation: BAB15709.1. Different initiation.
AK074043 mRNA. Translation: BAB84869.1. Different initiation.
AK289533 mRNA. Translation: BAF82222.1.
AK090438 mRNA. Translation: BAC03419.1. Different initiation.
AK074548 mRNA. Translation: BAC11052.1.
CH471139 Genomic DNA. Translation: EAW69441.1.
CH471139 Genomic DNA. Translation: EAW69444.1.
CH471139 Genomic DNA. Translation: EAW69446.1.
BC000158 mRNA. Translation: AAH00158.1.
BC009256 mRNA. Translation: AAH09256.1.
BC011667 mRNA. Translation: AAH11667.1.
BC020512 mRNA. Translation: AAH20512.1.
BC033749 mRNA. Translation: AAH33749.1.
BC035961 mRNA. Translation: AAH35961.1.
BC071644 mRNA. Translation: AAH71644.1.
BC071876 mRNA. Translation: AAH71876.1.
BC094816 mRNA. Translation: AAH94816.1.
CCDSiCCDS32867.1. [Q96GS6-2]
CCDS45902.1. [Q96GS6-1]
RefSeqiNP_001123583.1. NM_001130111.1. [Q96GS6-1]
NP_112490.3. NM_031213.3. [Q96GS6-2]
XP_011526640.1. XM_011528338.1. [Q96GS6-2]
UniGeneiHs.465542.
Hs.653679.

Genome annotation databases

EnsembliENST00000250974; ENSP00000250974; ENSG00000129968. [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968. [Q96GS6-1]
GeneIDi81926.
KEGGihsa:81926.
UCSCiuc002luf.4. human. [Q96GS6-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024419 mRNA. Translation: BAB15709.1. Different initiation.
AK074043 mRNA. Translation: BAB84869.1. Different initiation.
AK289533 mRNA. Translation: BAF82222.1.
AK090438 mRNA. Translation: BAC03419.1. Different initiation.
AK074548 mRNA. Translation: BAC11052.1.
CH471139 Genomic DNA. Translation: EAW69441.1.
CH471139 Genomic DNA. Translation: EAW69444.1.
CH471139 Genomic DNA. Translation: EAW69446.1.
BC000158 mRNA. Translation: AAH00158.1.
BC009256 mRNA. Translation: AAH09256.1.
BC011667 mRNA. Translation: AAH11667.1.
BC020512 mRNA. Translation: AAH20512.1.
BC033749 mRNA. Translation: AAH33749.1.
BC035961 mRNA. Translation: AAH35961.1.
BC071644 mRNA. Translation: AAH71644.1.
BC071876 mRNA. Translation: AAH71876.1.
BC094816 mRNA. Translation: AAH94816.1.
CCDSiCCDS32867.1. [Q96GS6-2]
CCDS45902.1. [Q96GS6-1]
RefSeqiNP_001123583.1. NM_001130111.1. [Q96GS6-1]
NP_112490.3. NM_031213.3. [Q96GS6-2]
XP_011526640.1. XM_011528338.1. [Q96GS6-2]
UniGeneiHs.465542.
Hs.653679.

3D structure databases

ProteinModelPortaliQ96GS6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123627. 19 interactions.
IntActiQ96GS6. 14 interactions.

Protein family/group databases

ESTHERihuman-ABHD17A. 5_AlphaBeta_hydrolase.
MEROPSiS09.052.

PTM databases

iPTMnetiQ96GS6.
PhosphoSiteiQ96GS6.
SwissPalmiQ96GS6.

Polymorphism and mutation databases

BioMutaiABHD17A.
DMDMi74751891.

Proteomic databases

EPDiQ96GS6.
MaxQBiQ96GS6.
PeptideAtlasiQ96GS6.
PRIDEiQ96GS6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000250974; ENSP00000250974; ENSG00000129968. [Q96GS6-2]
ENST00000292577; ENSP00000292577; ENSG00000129968. [Q96GS6-1]
GeneIDi81926.
KEGGihsa:81926.
UCSCiuc002luf.4. human. [Q96GS6-1]

Organism-specific databases

CTDi81926.
GeneCardsiABHD17A.
H-InvDBHIX0014598.
HIX0028829.
HIX0202559.
HGNCiHGNC:28756. ABHD17A.
HPAiHPA043270.
HPA047226.
neXtProtiNX_Q96GS6.
PharmGKBiPA134947443.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000000948.
HOVERGENiHBG061270.
InParanoidiQ96GS6.
OMAiACMYVRC.
OrthoDBiEOG091G0EV3.
PhylomeDBiQ96GS6.
TreeFamiTF314365.

Miscellaneous databases

ChiTaRSiABHD17A. human.
GenomeRNAii81926.
PROiQ96GS6.

Gene expression databases

BgeeiENSG00000129968.
CleanExiHS_FAM108A1.
ExpressionAtlasiQ96GS6. baseline and differential.
GenevisibleiQ96GS6. HS.

Family and domain databases

Gene3Di3.40.50.1820. 1 hit.
InterProiIPR029058. AB_hydrolase.
IPR022742. Hydrolase_4.
[Graphical view]
PfamiPF12146. Hydrolase_4. 1 hit.
[Graphical view]
SUPFAMiSSF53474. SSF53474. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiAB17A_HUMAN
AccessioniPrimary (citable) accession number: Q96GS6
Secondary accession number(s): A8K0G8
, D6W5Z9, Q6PJU2, Q8WUH9, Q9BWL0, Q9H7Q9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 122 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.