Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Probable palmitoyltransferase ZDHHC12

Gene

ZDHHC12

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Catalytic activityi

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei127 – 1271S-palmitoyl cysteine intermediateBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri97 – 14751DHHC-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

  • protein palmitoylation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Acyltransferase, Transferase

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Probable palmitoyltransferase ZDHHC12 (EC:2.3.1.225)
Alternative name(s):
Zinc finger DHHC domain-containing protein 12
Short name:
DHHC-12
Zinc finger protein 400
Gene namesi
Name:ZDHHC12
Synonyms:ZNF400
ORF Names:PSEC0008
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 9

Organism-specific databases

HGNCiHGNC:19159. ZDHHC12.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei10 – 3021HelicalSequence analysisAdd
BLAST
Transmembranei44 – 6421HelicalSequence analysisAdd
BLAST
Transmembranei141 – 16121HelicalSequence analysisAdd
BLAST
Transmembranei179 – 19921HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

  • endoplasmic reticulum Source: UniProtKB
  • Golgi apparatus Source: UniProtKB
  • integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38802.

Polymorphism and mutation databases

BioMutaiZDHHC12.
DMDMi126302619.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 267267Probable palmitoyltransferase ZDHHC12PRO_0000212884Add
BLAST

Proteomic databases

PaxDbiQ96GR4.
PRIDEiQ96GR4.

PTM databases

SwissPalmiQ96GR4.

Expressioni

Gene expression databases

BgeeiQ96GR4.
CleanExiHS_ZDHHC12.
ExpressionAtlasiQ96GR4. baseline and differential.
GenevisibleiQ96GR4. HS.

Organism-specific databases

HPAiHPA059339.

Interactioni

Protein-protein interaction databases

BioGridi124326. 2 interactions.
IntActiQ96GR4. 2 interactions.
STRINGi9606.ENSP00000361748.

Structurei

3D structure databases

ProteinModelPortaliQ96GR4.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domaini

The DHHC domain is required for palmitoyltransferase activity.By similarity

Sequence similaritiesi

Belongs to the DHHC palmitoyltransferase family.Curated
Contains 1 DHHC-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri97 – 14751DHHC-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

eggNOGiKOG1311. Eukaryota.
COG5273. LUCA.
GeneTreeiENSGT00550000074293.
HOVERGENiHBG058239.
InParanoidiQ96GR4.
KOiK18932.
OrthoDBiEOG73RBCK.
PhylomeDBiQ96GR4.
TreeFamiTF329809.

Family and domain databases

InterProiIPR001594. Znf_DHHC_palmitoyltrfase.
[Graphical view]
PfamiPF01529. zf-DHHC. 1 hit.
[Graphical view]
PROSITEiPS50216. ZF_DHHC. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96GR4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPWALLSPG VLVRTGHTVL TWGITLVLFL HDTELRQWEE QGELLLPLTF
60 70 80 90 100
LLLVLGSLLL YLAVSLMDPG YVNVQPQPQE ELKEEQTAMV PPAIPLRRCR
110 120 130 140 150
YCLVLQPLRA RHCRECRRCV RRYDHHCPWM ENCVGERNHP LFVVYLALQL
160 170 180 190 200
VVLLWGLYLA WSGLRFFQPW GQWLRSSGLL FATFLLLSLF SLVASLLLVS
210 220 230 240 250
HLYLVASNTT TWEFISSHRI AYLRQRPSNP FDRGLTRNLA HFFCGWPSGS
260
WETLWAEEEE EGSSPAV
Length:267
Mass (Da):30,813
Last modified:February 20, 2007 - v2
Checksum:i7A98B39BDFE43940
GO
Isoform 2 (identifier: Q96GR4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-240: Missing.

Show »
Length:215
Mass (Da):24,884
Checksum:iBC3460C10E72D69E
GO
Isoform 3 (identifier: Q96GR4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: T → TDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASP

Note: No experimental confirmation available.
Show »
Length:322
Mass (Da):36,541
Checksum:i9808BFA50D5F26A7
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti69 – 691P → S.
Corresponds to variant rs2298039 [ dbSNP | Ensembl ].
VAR_023833
Natural varianti172 – 1721Q → L.4 Publications
Corresponds to variant rs2900268 [ dbSNP | Ensembl ].
VAR_023834

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei33 – 331T → TDKSADELLATHSHSWNQHL QAFAQPGTHFPTSNCTPTPP TPVLPGPASLCSPASP in isoform 3. 1 PublicationVSP_016271
Alternative sequencei189 – 24052Missing in isoform 2. 2 PublicationsVSP_006945Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027430 mRNA. Translation: BAB55104.1.
AK075332 mRNA. Translation: BAC11553.1.
AK315746 mRNA. Translation: BAG38100.1.
AL441992 Genomic DNA. Translation: CAI15403.1.
AL441992 Genomic DNA. Translation: CAI15404.1.
AL441992 Genomic DNA. Translation: CAI15406.1.
CH471090 Genomic DNA. Translation: EAW87826.1.
BC009280 mRNA. Translation: AAH09280.1.
BC048251 mRNA. Translation: AAH48251.1.
CCDSiCCDS6909.1. [Q96GR4-1]
RefSeqiNP_001304944.1. NM_001318015.1.
NP_001304945.1. NM_001318016.1.
NP_001304949.1. NM_001318020.1.
NP_001304952.1. NM_001318023.1.
NP_116188.2. NM_032799.4.
UniGeneiHs.133122.

Genome annotation databases

EnsembliENST00000372663; ENSP00000361748; ENSG00000160446. [Q96GR4-1]
GeneIDi84885.
KEGGihsa:84885.
UCSCiuc004bvy.4. human. [Q96GR4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027430 mRNA. Translation: BAB55104.1.
AK075332 mRNA. Translation: BAC11553.1.
AK315746 mRNA. Translation: BAG38100.1.
AL441992 Genomic DNA. Translation: CAI15403.1.
AL441992 Genomic DNA. Translation: CAI15404.1.
AL441992 Genomic DNA. Translation: CAI15406.1.
CH471090 Genomic DNA. Translation: EAW87826.1.
BC009280 mRNA. Translation: AAH09280.1.
BC048251 mRNA. Translation: AAH48251.1.
CCDSiCCDS6909.1. [Q96GR4-1]
RefSeqiNP_001304944.1. NM_001318015.1.
NP_001304945.1. NM_001318016.1.
NP_001304949.1. NM_001318020.1.
NP_001304952.1. NM_001318023.1.
NP_116188.2. NM_032799.4.
UniGeneiHs.133122.

3D structure databases

ProteinModelPortaliQ96GR4.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124326. 2 interactions.
IntActiQ96GR4. 2 interactions.
STRINGi9606.ENSP00000361748.

PTM databases

SwissPalmiQ96GR4.

Polymorphism and mutation databases

BioMutaiZDHHC12.
DMDMi126302619.

Proteomic databases

PaxDbiQ96GR4.
PRIDEiQ96GR4.

Protocols and materials databases

DNASUi84885.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000372663; ENSP00000361748; ENSG00000160446. [Q96GR4-1]
GeneIDi84885.
KEGGihsa:84885.
UCSCiuc004bvy.4. human. [Q96GR4-1]

Organism-specific databases

CTDi84885.
GeneCardsiZDHHC12.
HGNCiHGNC:19159. ZDHHC12.
HPAiHPA059339.
neXtProtiNX_Q96GR4.
PharmGKBiPA38802.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1311. Eukaryota.
COG5273. LUCA.
GeneTreeiENSGT00550000074293.
HOVERGENiHBG058239.
InParanoidiQ96GR4.
KOiK18932.
OrthoDBiEOG73RBCK.
PhylomeDBiQ96GR4.
TreeFamiTF329809.

Miscellaneous databases

GenomeRNAii84885.
NextBioi75201.
PROiQ96GR4.

Gene expression databases

BgeeiQ96GR4.
CleanExiHS_ZDHHC12.
ExpressionAtlasiQ96GR4. baseline and differential.
GenevisibleiQ96GR4. HS.

Family and domain databases

InterProiIPR001594. Znf_DHHC_palmitoyltrfase.
[Graphical view]
PfamiPF01529. zf-DHHC. 1 hit.
[Graphical view]
PROSITEiPS50216. ZF_DHHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LEU-172.
    Tissue: Teratocarcinoma.
  2. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT LEU-172.
    Tissue: Teratocarcinoma.
  3. "DNA sequence and analysis of human chromosome 9."
    Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L.
    , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
    Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LEU-172.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT LEU-172.
    Tissue: Mammary gland and Uterus.

Entry informationi

Entry nameiZDH12_HUMAN
AccessioniPrimary (citable) accession number: Q96GR4
Secondary accession number(s): A6NH95
, B2RE03, Q5T265, Q5T267, Q5T268, Q86VT5, Q96T09
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: February 20, 2007
Last modified: May 11, 2016
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.