Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96GR4 (ZDH12_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Probable palmitoyltransferase ZDHHC12

EC=2.3.1.225
Alternative name(s):
Zinc finger DHHC domain-containing protein 12
Short name=DHHC-12
Zinc finger protein 400
Gene names
Name:ZDHHC12
Synonyms:ZNF400
ORF Names:PSEC0008
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length267 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Catalytic activity

Palmitoyl-CoA + [protein]-L-cysteine = [protein]-S-palmitoyl-L-cysteine + CoA.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Domain

The DHHC domain is required for palmitoyltransferase activity By similarity.

Sequence similarities

Belongs to the DHHC palmitoyltransferase family.

Contains 1 DHHC-type zinc finger.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96GR4-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96GR4-2)

The sequence of this isoform differs from the canonical sequence as follows:
     189-240: Missing.
Isoform 3 (identifier: Q96GR4-3)

The sequence of this isoform differs from the canonical sequence as follows:
     33-33: T → TDKSADELLATHSHSWNQHLQAFAQPGTHFPTSNCTPTPPTPVLPGPASLCSPASP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 267267Probable palmitoyltransferase ZDHHC12
PRO_0000212884

Regions

Transmembrane10 – 3021Helical; Potential
Transmembrane44 – 6421Helical; Potential
Transmembrane141 – 16121Helical; Potential
Transmembrane179 – 19921Helical; Potential
Zinc finger97 – 14751DHHC-type

Sites

Active site1271S-palmitoyl cysteine intermediate By similarity

Natural variations

Alternative sequence331T → TDKSADELLATHSHSWNQHL QAFAQPGTHFPTSNCTPTPP TPVLPGPASLCSPASP in isoform 3.
VSP_016271
Alternative sequence189 – 24052Missing in isoform 2.
VSP_006945
Natural variant691P → S.
Corresponds to variant rs2298039 [ dbSNP | Ensembl ].
VAR_023833
Natural variant1721Q → L. Ref.1 Ref.2 Ref.4 Ref.5
Corresponds to variant rs2900268 [ dbSNP | Ensembl ].
VAR_023834

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified February 20, 2007. Version 2.
Checksum: 7A98B39BDFE43940

FASTA26730,813
        10         20         30         40         50         60 
MAPWALLSPG VLVRTGHTVL TWGITLVLFL HDTELRQWEE QGELLLPLTF LLLVLGSLLL 

        70         80         90        100        110        120 
YLAVSLMDPG YVNVQPQPQE ELKEEQTAMV PPAIPLRRCR YCLVLQPLRA RHCRECRRCV 

       130        140        150        160        170        180 
RRYDHHCPWM ENCVGERNHP LFVVYLALQL VVLLWGLYLA WSGLRFFQPW GQWLRSSGLL 

       190        200        210        220        230        240 
FATFLLLSLF SLVASLLLVS HLYLVASNTT TWEFISSHRI AYLRQRPSNP FDRGLTRNLA 

       250        260 
HFFCGWPSGS WETLWAEEEE EGSSPAV 

« Hide

Isoform 2 [UniParc].

Checksum: BC3460C10E72D69E
Show »

FASTA21524,884
Isoform 3 [UniParc].

Checksum: 9808BFA50D5F26A7
Show »

FASTA32236,541

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT LEU-172.
Tissue: Teratocarcinoma.
[2]"Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y. expand/collapse author list , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT LEU-172.
Tissue: Teratocarcinoma.
[3]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LEU-172.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT LEU-172.
Tissue: Mammary gland and Uterus.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK027430 mRNA. Translation: BAB55104.1.
AK075332 mRNA. Translation: BAC11553.1.
AK315746 mRNA. Translation: BAG38100.1.
AL441992 Genomic DNA. Translation: CAI15403.1.
AL441992 Genomic DNA. Translation: CAI15404.1.
AL441992 Genomic DNA. Translation: CAI15406.1.
CH471090 Genomic DNA. Translation: EAW87826.1.
BC009280 mRNA. Translation: AAH09280.1.
BC048251 mRNA. Translation: AAH48251.1.
RefSeqNP_116188.2. NM_032799.4.
UniGeneHs.133122.

3D structure databases

ProteinModelPortalQ96GR4.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124326. 4 interactions.
IntActQ96GR4. 2 interactions.

Polymorphism databases

DMDM126302619.

Proteomic databases

PaxDbQ96GR4.
PRIDEQ96GR4.

Protocols and materials databases

DNASU84885.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000372663; ENSP00000361748; ENSG00000160446. [Q96GR4-1]
GeneID84885.
KEGGhsa:84885.
UCSCuc004bvy.3. human. [Q96GR4-1]
uc004bvz.3. human. [Q96GR4-3]

Organism-specific databases

CTD84885.
GeneCardsGC09M131484.
HGNCHGNC:19159. ZDHHC12.
HPAHPA059339.
neXtProtNX_Q96GR4.
PharmGKBPA38802.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG305404.
HOVERGENHBG058239.
OrthoDBEOG73RBCK.
PhylomeDBQ96GR4.
TreeFamTF329809.

Gene expression databases

ArrayExpressQ96GR4.
BgeeQ96GR4.
CleanExHS_ZDHHC12.
GenevestigatorQ96GR4.

Family and domain databases

InterProIPR001594. Znf_DHHC_palmitoyltrfase.
[Graphical view]
PfamPF01529. zf-DHHC. 1 hit.
[Graphical view]
PROSITEPS50216. ZF_DHHC. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi84885.
NextBio75201.
PROQ96GR4.

Entry information

Entry nameZDH12_HUMAN
AccessionPrimary (citable) accession number: Q96GR4
Secondary accession number(s): A6NH95 expand/collapse secondary AC list , B2RE03, Q5T265, Q5T267, Q5T268, Q86VT5, Q96T09
Entry history
Integrated into UniProtKB/Swiss-Prot: February 1, 2003
Last sequence update: February 20, 2007
Last modified: April 16, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM