SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96GJ1

- TRM2_HUMAN

UniProt

Q96GJ1 - TRM2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

tRNA (uracil(54)-C(5))-methyltransferase homolog

Gene
TRMT2B, CXorf34
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation By similarity.

Catalytic activityi

S-adenosyl-L-methionine + uracil(54) in tRNA = S-adenosyl-L-homocysteine + 5-methyluracil(54) in tRNA.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei323 – 3231S-adenosyl-L-methionine By similarity
Binding sitei373 – 3731S-adenosyl-L-methionine By similarity
Binding sitei423 – 4231S-adenosyl-L-methionine By similarity
Active sitei451 – 4511Nucleophile By similarity
Active sitei497 – 4971Proton acceptor By similarity

GO - Molecular functioni

  1. S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity Source: UniProtKB-EC
Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Biological processi

tRNA processing

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
tRNA (uracil(54)-C(5))-methyltransferase homolog (EC:2.1.1.35)
Alternative name(s):
TRM2 homolog
Gene namesi
Name:TRMT2B
Synonyms:CXorf34
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:25748. TRMT2B.

Subcellular locationi

GO - Cellular componenti

  1. mitochondrion Source: Ensembl
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164726782.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 504504tRNA (uracil(54)-C(5))-methyltransferase homologPRO_0000311932Add
BLAST

Proteomic databases

MaxQBiQ96GJ1.
PaxDbiQ96GJ1.
PRIDEiQ96GJ1.

PTM databases

PhosphoSiteiQ96GJ1.

Expressioni

Gene expression databases

ArrayExpressiQ96GJ1.
BgeeiQ96GJ1.
CleanExiHS_TRMT2B.
GenevestigatoriQ96GJ1.

Organism-specific databases

HPAiHPA035120.

Interactioni

Protein-protein interaction databases

BioGridi123044. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ96GJ1.
SMRiQ96GJ1. Positions 312-504.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG2265.
HOVERGENiHBG108599.
InParanoidiQ96GJ1.
KOiK15331.
OMAiHEGGYWR.
OrthoDBiEOG7327N9.
PhylomeDBiQ96GJ1.
TreeFamiTF352239.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR025714. Methyltranfer_dom.
IPR029063. SAM-dependent_MTases-like.
IPR025823. tRNA_(uracil-5-)_MeTrfase_met.
[Graphical view]
PfamiPF13847. Methyltransf_31. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 2 hits.
PROSITEiPS51687. SAM_MT_RNA_M5U. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96GJ1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MAGLKRRVPL HSLRYFISMV GLFSKPGLLP WYARNPPGWS QLFLGTVCKG    50
DFTRVIATKC QKGQKSQKKP SHLGPLDGSW QERLADVVTP LWRLSYEEQL 100
KVKFAAQKKI LQRLESYIQM LNGVSVTTAV PKSERLSCLL HPIIPSPVIN 150
GYRNKSTFSV NRGPDGNPKT VGFYLGTWRD GNVVCVQSNH LKNIPEKHSQ 200
VAQYYEVFLR QSPLEPCLVF HEGGYWRELT VRTNSQGHTM AIITFHPQKL 250
SQEELHVQKE IVKEFFIRGP GAACGLTSLY FQESTMTRCS HQQSPYQLLF 300
GEPYIFEELL SLKIRISPDA FFQINTAGAE MLYRTVGELT GVNSDTILLD 350
ICCGTGVIGL SLAQHTSRVL GIELLEQAVE DARWTAAFNG ITNSEFHTGQ 400
AEKILPGLLK SKEDGQSIVA VVNPARAGLH YKVIQAIRNF RAIHTLVFVS 450
CKLHGESTRN VIELCCPPDP AKKLLGEPFV LQQAVPVDLF PHTPHCELVL 500
LFTR 504
Length:504
Mass (Da):56,476
Last modified:December 1, 2001 - v1
Checksum:iD7A28E168AC9C366
GO
Isoform 2 (identifier: Q96GJ1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     464-504: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS

Note: No experimental confirmation available.

Show »
Length:494
Mass (Da):55,006
Checksum:i22B3CD7F012C136F
GO
Isoform 3 (identifier: Q96GJ1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-146: Missing.

Note: No experimental confirmation available.

Show »
Length:459
Mass (Da):51,485
Checksum:i2000E09C0715483C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti12 – 121S → R.
Corresponds to variant rs7064613 [ dbSNP | Ensembl ].
VAR_037355

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei102 – 14645Missing in isoform 3. VSP_029643Add
BLAST
Alternative sequencei464 – 50441LCCPP…LLFTR → RSLILLECSGMVSAHCSLHL PGSSDSPASAS in isoform 2. VSP_029644Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti238 – 2381H → R in BAB14223. 1 Publication
Sequence conflicti451 – 4511C → R in CAI46112. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022749 mRNA. Translation: BAB14223.1.
AL832849 mRNA. Translation: CAI46112.1.
AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42155.1.
AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42156.1.
Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42658.1.
Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42657.1.
AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42997.1.
AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42998.1.
CH471115 Genomic DNA. Translation: EAX02831.1.
CH471115 Genomic DNA. Translation: EAX02837.1.
BC007526 mRNA. Translation: AAH07526.1.
BC008067 mRNA. Translation: AAH08067.2.
BC009437 mRNA. Translation: AAH09437.1.
BC020116 mRNA. Translation: AAH20116.1.
BC034272 mRNA. Translation: AAH34272.1.
CCDSiCCDS14477.1. [Q96GJ1-1]
CCDS55464.1. [Q96GJ1-3]
RefSeqiNP_001161442.1. NM_001167970.1. [Q96GJ1-1]
NP_001161443.1. NM_001167971.1. [Q96GJ1-3]
NP_001161444.1. NM_001167972.1. [Q96GJ1-1]
NP_079193.2. NM_024917.5. [Q96GJ1-1]
XP_005262252.1. XM_005262195.1. [Q96GJ1-1]
XP_005262253.1. XM_005262196.1. [Q96GJ1-1]
XP_006724768.1. XM_006724705.1. [Q96GJ1-1]
XP_006724770.1. XM_006724707.1. [Q96GJ1-3]
UniGeneiHs.496501.

Genome annotation databases

EnsembliENST00000338687; ENSP00000340970; ENSG00000188917. [Q96GJ1-3]
ENST00000372935; ENSP00000362026; ENSG00000188917. [Q96GJ1-1]
ENST00000372936; ENSP00000362027; ENSG00000188917. [Q96GJ1-1]
ENST00000372939; ENSP00000362030; ENSG00000188917. [Q96GJ1-3]
ENST00000545398; ENSP00000438134; ENSG00000188917. [Q96GJ1-1]
GeneIDi79979.
KEGGihsa:79979.
UCSCiuc004egq.3. human. [Q96GJ1-1]
uc004egv.3. human. [Q96GJ1-3]

Polymorphism databases

DMDMi74762656.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK022749 mRNA. Translation: BAB14223.1 .
AL832849 mRNA. Translation: CAI46112.1 .
AL133275 , AL109952 , Z97985 Genomic DNA. Translation: CAI42155.1 .
AL133275 , AL109952 , Z97985 Genomic DNA. Translation: CAI42156.1 .
Z97985 , AL109952 , AL133275 Genomic DNA. Translation: CAI42658.1 .
Z97985 , AL109952 , AL133275 Genomic DNA. Translation: CAI42657.1 .
AL109952 , AL133275 , Z97985 Genomic DNA. Translation: CAI42997.1 .
AL109952 , AL133275 , Z97985 Genomic DNA. Translation: CAI42998.1 .
CH471115 Genomic DNA. Translation: EAX02831.1 .
CH471115 Genomic DNA. Translation: EAX02837.1 .
BC007526 mRNA. Translation: AAH07526.1 .
BC008067 mRNA. Translation: AAH08067.2 .
BC009437 mRNA. Translation: AAH09437.1 .
BC020116 mRNA. Translation: AAH20116.1 .
BC034272 mRNA. Translation: AAH34272.1 .
CCDSi CCDS14477.1. [Q96GJ1-1 ]
CCDS55464.1. [Q96GJ1-3 ]
RefSeqi NP_001161442.1. NM_001167970.1. [Q96GJ1-1 ]
NP_001161443.1. NM_001167971.1. [Q96GJ1-3 ]
NP_001161444.1. NM_001167972.1. [Q96GJ1-1 ]
NP_079193.2. NM_024917.5. [Q96GJ1-1 ]
XP_005262252.1. XM_005262195.1. [Q96GJ1-1 ]
XP_005262253.1. XM_005262196.1. [Q96GJ1-1 ]
XP_006724768.1. XM_006724705.1. [Q96GJ1-1 ]
XP_006724770.1. XM_006724707.1. [Q96GJ1-3 ]
UniGenei Hs.496501.

3D structure databases

ProteinModelPortali Q96GJ1.
SMRi Q96GJ1. Positions 312-504.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123044. 2 interactions.

PTM databases

PhosphoSitei Q96GJ1.

Polymorphism databases

DMDMi 74762656.

Proteomic databases

MaxQBi Q96GJ1.
PaxDbi Q96GJ1.
PRIDEi Q96GJ1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000338687 ; ENSP00000340970 ; ENSG00000188917 . [Q96GJ1-3 ]
ENST00000372935 ; ENSP00000362026 ; ENSG00000188917 . [Q96GJ1-1 ]
ENST00000372936 ; ENSP00000362027 ; ENSG00000188917 . [Q96GJ1-1 ]
ENST00000372939 ; ENSP00000362030 ; ENSG00000188917 . [Q96GJ1-3 ]
ENST00000545398 ; ENSP00000438134 ; ENSG00000188917 . [Q96GJ1-1 ]
GeneIDi 79979.
KEGGi hsa:79979.
UCSCi uc004egq.3. human. [Q96GJ1-1 ]
uc004egv.3. human. [Q96GJ1-3 ]

Organism-specific databases

CTDi 79979.
GeneCardsi GC0XM100264.
H-InvDB HIX0016920.
HIX0029044.
HGNCi HGNC:25748. TRMT2B.
HPAi HPA035120.
neXtProti NX_Q96GJ1.
PharmGKBi PA164726782.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2265.
HOVERGENi HBG108599.
InParanoidi Q96GJ1.
KOi K15331.
OMAi HEGGYWR.
OrthoDBi EOG7327N9.
PhylomeDBi Q96GJ1.
TreeFami TF352239.

Miscellaneous databases

ChiTaRSi TRMT2B. human.
GenomeRNAii 79979.
NextBioi 70009.
PROi Q96GJ1.

Gene expression databases

ArrayExpressi Q96GJ1.
Bgeei Q96GJ1.
CleanExi HS_TRMT2B.
Genevestigatori Q96GJ1.

Family and domain databases

Gene3Di 3.40.50.150. 1 hit.
InterProi IPR025714. Methyltranfer_dom.
IPR029063. SAM-dependent_MTases-like.
IPR025823. tRNA_(uracil-5-)_MeTrfase_met.
[Graphical view ]
Pfami PF13847. Methyltransf_31. 1 hit.
[Graphical view ]
SUPFAMi SSF53335. SSF53335. 2 hits.
PROSITEi PS51687. SAM_MT_RNA_M5U. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Teratocarcinoma.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Lymph node.
  3. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Brain, Colon, Lymph, Placenta and Skin.

Entry informationi

Entry nameiTRM2_HUMAN
AccessioniPrimary (citable) accession number: Q96GJ1
Secondary accession number(s): A6NDG5
, A6NEI9, A6NMG6, Q5JPF0, Q5JVY6, Q96HU7, Q96IH9, Q9H9K2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 114 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi