Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96GJ1

- TRM2_HUMAN

UniProt

Q96GJ1 - TRM2_HUMAN

Protein

tRNA (uracil(54)-C(5))-methyltransferase homolog

Gene

TRMT2B

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation By similarity.By similarity

    Catalytic activityi

    S-adenosyl-L-methionine + uracil(54) in tRNA = S-adenosyl-L-homocysteine + 5-methyluracil(54) in tRNA.

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Binding sitei323 – 3231S-adenosyl-L-methioninePROSITE-ProRule annotation
    Binding sitei373 – 3731S-adenosyl-L-methioninePROSITE-ProRule annotation
    Binding sitei423 – 4231S-adenosyl-L-methioninePROSITE-ProRule annotation
    Active sitei451 – 4511NucleophilePROSITE-ProRule annotation
    Active sitei497 – 4971Proton acceptorBy similarity

    GO - Molecular functioni

    1. S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity Source: UniProtKB-EC

    Keywords - Molecular functioni

    Methyltransferase, Transferase

    Keywords - Biological processi

    tRNA processing

    Keywords - Ligandi

    S-adenosyl-L-methionine

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    tRNA (uracil(54)-C(5))-methyltransferase homolog (EC:2.1.1.35)
    Alternative name(s):
    TRM2 homolog
    Gene namesi
    Name:TRMT2B
    Synonyms:CXorf34
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:25748. TRMT2B.

    Subcellular locationi

    GO - Cellular componenti

    1. mitochondrion Source: Ensembl

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164726782.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 504504tRNA (uracil(54)-C(5))-methyltransferase homologPRO_0000311932Add
    BLAST

    Proteomic databases

    MaxQBiQ96GJ1.
    PaxDbiQ96GJ1.
    PRIDEiQ96GJ1.

    PTM databases

    PhosphoSiteiQ96GJ1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ96GJ1.
    BgeeiQ96GJ1.
    CleanExiHS_TRMT2B.
    GenevestigatoriQ96GJ1.

    Organism-specific databases

    HPAiHPA035120.

    Interactioni

    Protein-protein interaction databases

    BioGridi123044. 2 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96GJ1.
    SMRiQ96GJ1. Positions 312-504.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the class I-like SAM-binding methyltransferase superfamily. RNA M5U methyltransferase family.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG2265.
    HOVERGENiHBG108599.
    InParanoidiQ96GJ1.
    KOiK15331.
    OMAiHEGGYWR.
    OrthoDBiEOG7327N9.
    PhylomeDBiQ96GJ1.
    TreeFamiTF352239.

    Family and domain databases

    Gene3Di3.40.50.150. 1 hit.
    InterProiIPR025714. Methyltranfer_dom.
    IPR029063. SAM-dependent_MTases-like.
    IPR025823. tRNA_(uracil-5-)_MeTrfase_met.
    [Graphical view]
    PfamiPF13847. Methyltransf_31. 1 hit.
    [Graphical view]
    SUPFAMiSSF53335. SSF53335. 2 hits.
    PROSITEiPS51687. SAM_MT_RNA_M5U. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96GJ1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGLKRRVPL HSLRYFISMV GLFSKPGLLP WYARNPPGWS QLFLGTVCKG    50
    DFTRVIATKC QKGQKSQKKP SHLGPLDGSW QERLADVVTP LWRLSYEEQL 100
    KVKFAAQKKI LQRLESYIQM LNGVSVTTAV PKSERLSCLL HPIIPSPVIN 150
    GYRNKSTFSV NRGPDGNPKT VGFYLGTWRD GNVVCVQSNH LKNIPEKHSQ 200
    VAQYYEVFLR QSPLEPCLVF HEGGYWRELT VRTNSQGHTM AIITFHPQKL 250
    SQEELHVQKE IVKEFFIRGP GAACGLTSLY FQESTMTRCS HQQSPYQLLF 300
    GEPYIFEELL SLKIRISPDA FFQINTAGAE MLYRTVGELT GVNSDTILLD 350
    ICCGTGVIGL SLAQHTSRVL GIELLEQAVE DARWTAAFNG ITNSEFHTGQ 400
    AEKILPGLLK SKEDGQSIVA VVNPARAGLH YKVIQAIRNF RAIHTLVFVS 450
    CKLHGESTRN VIELCCPPDP AKKLLGEPFV LQQAVPVDLF PHTPHCELVL 500
    LFTR 504
    Length:504
    Mass (Da):56,476
    Last modified:December 1, 2001 - v1
    Checksum:iD7A28E168AC9C366
    GO
    Isoform 2 (identifier: Q96GJ1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         464-504: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS

    Note: No experimental confirmation available.

    Show »
    Length:494
    Mass (Da):55,006
    Checksum:i22B3CD7F012C136F
    GO
    Isoform 3 (identifier: Q96GJ1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         102-146: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:459
    Mass (Da):51,485
    Checksum:i2000E09C0715483C
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti238 – 2381H → R in BAB14223. (PubMed:14702039)Curated
    Sequence conflicti451 – 4511C → R in CAI46112. (PubMed:17974005)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti12 – 121S → R.
    Corresponds to variant rs7064613 [ dbSNP | Ensembl ].
    VAR_037355

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei102 – 14645Missing in isoform 3. 1 PublicationVSP_029643Add
    BLAST
    Alternative sequencei464 – 50441LCCPP…LLFTR → RSLILLECSGMVSAHCSLHL PGSSDSPASAS in isoform 2. 1 PublicationVSP_029644Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022749 mRNA. Translation: BAB14223.1.
    AL832849 mRNA. Translation: CAI46112.1.
    AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42155.1.
    AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42156.1.
    Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42658.1.
    Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42657.1.
    AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42997.1.
    AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42998.1.
    CH471115 Genomic DNA. Translation: EAX02831.1.
    CH471115 Genomic DNA. Translation: EAX02837.1.
    BC007526 mRNA. Translation: AAH07526.1.
    BC008067 mRNA. Translation: AAH08067.2.
    BC009437 mRNA. Translation: AAH09437.1.
    BC020116 mRNA. Translation: AAH20116.1.
    BC034272 mRNA. Translation: AAH34272.1.
    CCDSiCCDS14477.1. [Q96GJ1-1]
    CCDS55464.1. [Q96GJ1-3]
    RefSeqiNP_001161442.1. NM_001167970.1. [Q96GJ1-1]
    NP_001161443.1. NM_001167971.1. [Q96GJ1-3]
    NP_001161444.1. NM_001167972.1. [Q96GJ1-1]
    NP_079193.2. NM_024917.5. [Q96GJ1-1]
    XP_005262252.1. XM_005262195.1. [Q96GJ1-1]
    XP_005262253.1. XM_005262196.1. [Q96GJ1-1]
    XP_006724768.1. XM_006724705.1. [Q96GJ1-1]
    XP_006724770.1. XM_006724707.1. [Q96GJ1-3]
    UniGeneiHs.496501.

    Genome annotation databases

    EnsembliENST00000372935; ENSP00000362026; ENSG00000188917. [Q96GJ1-1]
    ENST00000372936; ENSP00000362027; ENSG00000188917. [Q96GJ1-1]
    ENST00000372939; ENSP00000362030; ENSG00000188917. [Q96GJ1-3]
    ENST00000545398; ENSP00000438134; ENSG00000188917. [Q96GJ1-1]
    GeneIDi79979.
    KEGGihsa:79979.
    UCSCiuc004egq.3. human. [Q96GJ1-1]
    uc004egv.3. human. [Q96GJ1-3]

    Polymorphism databases

    DMDMi74762656.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK022749 mRNA. Translation: BAB14223.1 .
    AL832849 mRNA. Translation: CAI46112.1 .
    AL133275 , AL109952 , Z97985 Genomic DNA. Translation: CAI42155.1 .
    AL133275 , AL109952 , Z97985 Genomic DNA. Translation: CAI42156.1 .
    Z97985 , AL109952 , AL133275 Genomic DNA. Translation: CAI42658.1 .
    Z97985 , AL109952 , AL133275 Genomic DNA. Translation: CAI42657.1 .
    AL109952 , AL133275 , Z97985 Genomic DNA. Translation: CAI42997.1 .
    AL109952 , AL133275 , Z97985 Genomic DNA. Translation: CAI42998.1 .
    CH471115 Genomic DNA. Translation: EAX02831.1 .
    CH471115 Genomic DNA. Translation: EAX02837.1 .
    BC007526 mRNA. Translation: AAH07526.1 .
    BC008067 mRNA. Translation: AAH08067.2 .
    BC009437 mRNA. Translation: AAH09437.1 .
    BC020116 mRNA. Translation: AAH20116.1 .
    BC034272 mRNA. Translation: AAH34272.1 .
    CCDSi CCDS14477.1. [Q96GJ1-1 ]
    CCDS55464.1. [Q96GJ1-3 ]
    RefSeqi NP_001161442.1. NM_001167970.1. [Q96GJ1-1 ]
    NP_001161443.1. NM_001167971.1. [Q96GJ1-3 ]
    NP_001161444.1. NM_001167972.1. [Q96GJ1-1 ]
    NP_079193.2. NM_024917.5. [Q96GJ1-1 ]
    XP_005262252.1. XM_005262195.1. [Q96GJ1-1 ]
    XP_005262253.1. XM_005262196.1. [Q96GJ1-1 ]
    XP_006724768.1. XM_006724705.1. [Q96GJ1-1 ]
    XP_006724770.1. XM_006724707.1. [Q96GJ1-3 ]
    UniGenei Hs.496501.

    3D structure databases

    ProteinModelPortali Q96GJ1.
    SMRi Q96GJ1. Positions 312-504.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123044. 2 interactions.

    PTM databases

    PhosphoSitei Q96GJ1.

    Polymorphism databases

    DMDMi 74762656.

    Proteomic databases

    MaxQBi Q96GJ1.
    PaxDbi Q96GJ1.
    PRIDEi Q96GJ1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372935 ; ENSP00000362026 ; ENSG00000188917 . [Q96GJ1-1 ]
    ENST00000372936 ; ENSP00000362027 ; ENSG00000188917 . [Q96GJ1-1 ]
    ENST00000372939 ; ENSP00000362030 ; ENSG00000188917 . [Q96GJ1-3 ]
    ENST00000545398 ; ENSP00000438134 ; ENSG00000188917 . [Q96GJ1-1 ]
    GeneIDi 79979.
    KEGGi hsa:79979.
    UCSCi uc004egq.3. human. [Q96GJ1-1 ]
    uc004egv.3. human. [Q96GJ1-3 ]

    Organism-specific databases

    CTDi 79979.
    GeneCardsi GC0XM100264.
    H-InvDB HIX0016920.
    HIX0029044.
    HGNCi HGNC:25748. TRMT2B.
    HPAi HPA035120.
    neXtProti NX_Q96GJ1.
    PharmGKBi PA164726782.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG2265.
    HOVERGENi HBG108599.
    InParanoidi Q96GJ1.
    KOi K15331.
    OMAi HEGGYWR.
    OrthoDBi EOG7327N9.
    PhylomeDBi Q96GJ1.
    TreeFami TF352239.

    Miscellaneous databases

    ChiTaRSi TRMT2B. human.
    GenomeRNAii 79979.
    NextBioi 70009.
    PROi Q96GJ1.

    Gene expression databases

    ArrayExpressi Q96GJ1.
    Bgeei Q96GJ1.
    CleanExi HS_TRMT2B.
    Genevestigatori Q96GJ1.

    Family and domain databases

    Gene3Di 3.40.50.150. 1 hit.
    InterProi IPR025714. Methyltranfer_dom.
    IPR029063. SAM-dependent_MTases-like.
    IPR025823. tRNA_(uracil-5-)_MeTrfase_met.
    [Graphical view ]
    Pfami PF13847. Methyltransf_31. 1 hit.
    [Graphical view ]
    SUPFAMi SSF53335. SSF53335. 2 hits.
    PROSITEi PS51687. SAM_MT_RNA_M5U. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Teratocarcinoma.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Lymph node.
    3. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Brain, Colon, Lymph, Placenta and Skin.

    Entry informationi

    Entry nameiTRM2_HUMAN
    AccessioniPrimary (citable) accession number: Q96GJ1
    Secondary accession number(s): A6NDG5
    , A6NEI9, A6NMG6, Q5JPF0, Q5JVY6, Q96HU7, Q96IH9, Q9H9K2
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3