Q96GJ1 (TRM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: tRNA (uracil(54)-C(5))-methyltransferase homolog EC=2.1.1.35 Alternative name(s): TRM2 homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 504 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Probable S-adenosyl-L-methionine-dependent methyltransferase that catalyzes the formation of 5-methyl-uridine at position 54 (m5U54) in all tRNA. May also have a role in tRNA stabilization or maturation By similarity. |
| Catalytic activity | S-adenosyl-L-methionine + uridine54 in tRNA = S-adenosyl-L-homocysteine + 5-methyluridine54 in tRNA. |
| Sequence similarities | Belongs to the methyltransferase superfamily. RNA M5U methyltransferase family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | tRNA processing |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | S-adenosyl-L-methionine |
| Molecular function | Methyltransferase Transferase |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | mitochondrion Inferred from electronic annotation. Source: Compara |
| Molecular_function | S-adenosylmethionine-dependent tRNA (m5U54) methyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96GJ1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96GJ1-2) The sequence of this isoform differs from the canonical sequence as follows: 464-504: LCCPPDPAKKLLGEPFVLQQAVPVDLFPHTPHCELVLLFTR → RSLILLECSGMVSAHCSLHLPGSSDSPASAS | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96GJ1-3) The sequence of this isoform differs from the canonical sequence as follows: 102-146: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 504 | 504 | tRNA (uracil(54)-C(5))-methyltransferase homolog | PRO_0000311932 | |||||
Sites | |||||||||
| Active site | 451 | 1 | Nucleophile By similarity | ||||||
| Binding site | 323 | 1 | S-adenosyl-L-methionine By similarity | ||||||
| Binding site | 373 | 1 | S-adenosyl-L-methionine By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 102 – 146 | 45 | Missing in isoform 3. | VSP_029643 | |||||
| Alternative sequence | 464 – 504 | 41 | LCCPP…LLFTR → RSLILLECSGMVSAHCSLHL PGSSDSPASAS in isoform 2. | VSP_029644 | |||||
| Natural variant | 12 | 1 | S → R. Corresponds to variant rs7064613 [ dbSNP | Ensembl ]. | VAR_037355 | |||||
Experimental info | |||||||||
| Sequence conflict | 238 | 1 | H → R in BAB14223. Ref.1 | ||||||
| Sequence conflict | 451 | 1 | C → R in CAI46112. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK022749 mRNA. Translation: BAB14223.1. AL832849 mRNA. Translation: CAI46112.1. AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42155.1. AL133275, AL109952, Z97985 Genomic DNA. Translation: CAI42156.1. Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42658.1. Z97985, AL109952, AL133275 Genomic DNA. Translation: CAI42657.1. AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42997.1. AL109952, AL133275, Z97985 Genomic DNA. Translation: CAI42998.1. CH471115 Genomic DNA. Translation: EAX02831.1. CH471115 Genomic DNA. Translation: EAX02837.1. BC007526 mRNA. Translation: AAH07526.1. BC008067 mRNA. Translation: AAH08067.2. BC009437 mRNA. Translation: AAH09437.1. BC020116 mRNA. Translation: AAH20116.1. BC034272 mRNA. Translation: AAH34272.1. |
| IPI | IPI00550091. IPI00747797. IPI00749054. |
| RefSeq | NP_001161442.1. NM_001167970.1. NP_001161443.1. NM_001167971.1. NP_001161444.1. NM_001167972.1. NP_079193.2. NM_024917.5. |
| UniGene | Hs.496501. |
3D structure databases | |
| ProteinModelPortal | Q96GJ1. |
| ModBase | Search... |
PTM databases | |
| PhosphoSite | Q96GJ1. |
Polymorphism databases | |
| DMDM | 74762656. |
Proteomic databases | |
| PaxDb | Q96GJ1. |
| PRIDE | Q96GJ1. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338687; ENSP00000340970; ENSG00000188917. ENST00000372935; ENSP00000362026; ENSG00000188917. ENST00000372936; ENSP00000362027; ENSG00000188917. ENST00000372939; ENSP00000362030; ENSG00000188917. ENST00000545398; ENSP00000438134; ENSG00000188917. |
| GeneID | 79979. |
| KEGG | hsa:79979. |
| UCSC | uc004egq.3. human. uc004egv.3. human. |
Organism-specific databases | |
| CTD | 79979. |
| GeneCards | GC0XM100264. |
| H-InvDB | HIX0016920. HIX0029044. |
| HGNC | HGNC:25748. TRMT2B. |
| HPA | HPA035120. |
| neXtProt | NX_Q96GJ1. |
| PharmGKB | PA164726782. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2265. |
| HOVERGEN | HBG108599. |
| InParanoid | Q96GJ1. |
| KO | K15331. |
| OMA | STMTRCS. |
| PhylomeDB | Q96GJ1. |
Gene expression databases | |
| ArrayExpress | Q96GJ1. |
| Bgee | Q96GJ1. |
| CleanEx | HS_TRMT2B. |
| Genevestigator | Q96GJ1. |
Family and domain databases | |
| InterPro | IPR025714. Methyltranfer_dom. IPR025823. tRNA_(uracil-5-)_MeTrfase_met. [Graphical view] |
| Pfam | PF13847. Methyltransf_31. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TRMT2B. human. |
| GenomeRNAi | 79979. |
| NextBio | 70009. |
Entry information
| Entry name | TRM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96GJ1 Secondary accession number(s): A6NDG5 Q9H9K2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
