Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Aurora kinase B

Gene

AURKB

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Involved in the bipolar attachment of spindle microtubules to kinetochores and is a key regulator for the onset of cytokinesis during mitosis. Required for central/midzone spindle assembly and cleavage furrow formation. Key component of the cytokinesis checkpoint, a process required to delay abscission to prevent both premature resolution of intercellular chromosome bridges and accumulation of DNA damage: phosphorylates CHMP4C, leading to retain abscission-competent VPS4 (VPS4A and/or VPS4B) at the midbody ring until abscission checkpoint signaling is terminated at late cytokinesis (PubMed:22422861, PubMed:24814515). AURKB phosphorylates the CPC complex subunits BIRC5/survivin, CDCA8/borealin and INCENP. Phosphorylation of INCENP leads to increased AURKB activity. Other known AURKB substrates involved in centromeric functions and mitosis are CENPA, DES/desmin, GPAF, KIF2C, NSUN2, RACGAP1, SEPT1, VIM/vimentin, GSG2/Haspin, and histone H3. A positive feedback loop involving GSG2 and AURKB contributes to localization of CPC to centromeres. Phosphorylation of VIM controls vimentin filament segregation in cytokinetic process, whereas histone H3 is phosphorylated at 'Ser-10' and 'Ser-28' during mitosis (H3S10ph and H3S28ph, respectively). A positive feedback between GSG2 and AURKB contributes to CPC localization. AURKB is also required for kinetochore localization of BUB1 and SGO1. Phosphorylation of p53/TP53 negatively regulates its transcriptional activity. Key regulator of active promoters in resting B- and T-lymphocytes: acts by mediating phosphorylation of H3S28ph at active promoters in resting B-cells, inhibiting RNF2/RING1B-mediated ubiquitination of histone H2A and enhancing binding and activity of the USP16 deubiquitinase at transcribed genes.19 Publications

Catalytic activityi

ATP + a protein = ADP + a phosphoprotein.

Cofactori

Enzyme regulationi

Activity is greatly increased when AURKB is within the CPC complex. In particular, AURKB-phosphorylated INCENP acts as an activator of AURKB. Positive feedback between GSG2 and AURKB contributes to CPC localization.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei106 – 1061ATPPROSITE-ProRule annotation
Active sitei200 – 2001Proton acceptorPROSITE-ProRule annotation

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi83 – 919ATPPROSITE-ProRule annotation

GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • histone serine kinase activity Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • protein serine/threonine/tyrosine kinase activity Source: UniProtKB
  • protein serine/threonine kinase activity Source: FlyBase

GO - Biological processi

  • abscission Source: UniProtKB
  • aging Source: Ensembl
  • anaphase-promoting complex-dependent catabolic process Source: Reactome
  • attachment of spindle microtubules to kinetochore Source: UniProtKB
  • cell proliferation Source: Ensembl
  • cellular response to UV Source: UniProtKB
  • cleavage furrow formation Source: UniProtKB
  • histone H3-S28 phosphorylation Source: UniProtKB
  • histone modification Source: UniProtKB
  • mitotic spindle midzone assembly Source: UniProtKB
  • negative regulation of B cell apoptotic process Source: UniProtKB
  • negative regulation of cytokinesis Source: UniProtKB
  • negative regulation of protein binding Source: UniProtKB
  • negative regulation of transcription from RNA polymerase II promoter Source: UniProtKB
  • positive regulation of cytokinesis Source: UniProtKB
  • positive regulation of telomerase activity Source: BHF-UCL
  • positive regulation of telomere capping Source: BHF-UCL
  • positive regulation of telomere maintenance via telomerase Source: BHF-UCL
  • protein autophosphorylation Source: UniProtKB
  • protein localization to kinetochore Source: UniProtKB
  • protein phosphorylation Source: UniProtKB
  • protein sumoylation Source: Reactome
  • protein ubiquitination involved in ubiquitin-dependent protein catabolic process Source: Reactome
  • regulation of chromosome segregation Source: UniProtKB
  • regulation of signal transduction by p53 class mediator Source: Reactome
  • sister chromatid cohesion Source: Reactome
  • spindle checkpoint Source: InterPro
  • spindle organization Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Kinase, Serine/threonine-protein kinase, Transferase

Keywords - Biological processi

Cell cycle, Cell division, Mitosis

Keywords - Ligandi

ATP-binding, Magnesium, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-174178. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-4615885. SUMOylation of DNA replication proteins.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6804756. Regulation of TP53 Activity through Phosphorylation.
R-HSA-68877. Mitotic Prometaphase.
SignaLinkiQ96GD4.
SIGNORiQ96GD4.

Names & Taxonomyi

Protein namesi
Recommended name:
Aurora kinase B (EC:2.7.11.1)
Alternative name(s):
Aurora 1
Aurora- and IPL1-like midbody-associated protein 1
Short name:
AIM-1
Aurora/IPL1-related kinase 2
Short name:
ARK-2
Short name:
Aurora-related kinase 2
STK-1
Serine/threonine-protein kinase 12
Serine/threonine-protein kinase 5
Serine/threonine-protein kinase aurora-B
Gene namesi
Name:AURKB
Synonyms:AIK2, AIM1, AIRK2, ARK2, STK1, STK12, STK5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11390. AURKB.

Subcellular locationi

  • Nucleus
  • Chromosome
  • Chromosomecentromere
  • Cytoplasmcytoskeletonspindle
  • Midbody

  • Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalized with gamma tubulin in the mid-body. Proper localization of the active, Thr-232-phosphorylated form during metaphase may be dependent upon interaction with SPDYC. Colocalized with SIRT2 during cytokinesis with the midbody.

GO - Cellular componenti

  • chromocenter Source: Ensembl
  • chromosome passenger complex Source: UniProtKB
  • condensed chromosome, centromeric region Source: UniProtKB
  • condensed nuclear chromosome, centromeric region Source: BHF-UCL
  • cytosol Source: Reactome
  • intercellular bridge Source: HPA
  • midbody Source: UniProtKB
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • spindle Source: UniProtKB
  • spindle microtubule Source: GO_Central
  • spindle midzone Source: GO_Central
  • spindle pole centrosome Source: GO_Central
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Nucleus

Pathology & Biotechi

Involvement in diseasei

Disruptive regulation of expression is a possible mechanism of the perturbation of chromosomal integrity in cancer cells through its dominant-negative effect on cytokinesis.

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi106 – 1061K → R: Leads to loss of kinase activity and severely impairs mitotic progression. 4 Publications

Organism-specific databases

PharmGKBiPA36199.

Chemistry

ChEMBLiCHEMBL3430911.
GuidetoPHARMACOLOGYi1937.

Polymorphism and mutation databases

BioMutaiAURKB.
DMDMi317373473.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 344344Aurora kinase BPRO_0000085656Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei35 – 351PhosphothreonineCombined sources
Modified residuei62 – 621PhosphoserineCombined sources
Modified residuei64 – 641PhosphothreonineCombined sources
Modified residuei227 – 2271PhosphoserineCombined sources
Modified residuei232 – 2321Phosphothreonine; by autocatalysis1 Publication

Post-translational modificationi

The phosphorylation of Thr-232 requires the binding to INCENP and occurs by means of an autophosphorylation mechanism. Thr-232 phosphorylation is indispensable for the AURKB kinase activity.1 Publication
Ubiquitinated by different BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complexes. Ubiquitinated by the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, ubiquitination leads to removal from mitotic chromosomes and is required for cytokinesis. During anaphase, the BCR(KLHL21) E3 ubiquitin ligase complex recruits the CPC complex from chromosomes to the spindle midzone and mediates the ubiquitination of AURKB. Ubiquitination of AURKB by BCR(KLHL21) E3 ubiquitin ligase complex may not lead to its degradation by the proteasome.2 Publications

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

EPDiQ96GD4.
MaxQBiQ96GD4.
PaxDbiQ96GD4.
PeptideAtlasiQ96GD4.
PRIDEiQ96GD4.

PTM databases

iPTMnetiQ96GD4.
PhosphoSiteiQ96GD4.
SwissPalmiQ96GD4.

Expressioni

Tissue specificityi

High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase.2 Publications

Inductioni

Expression is cell cycle-regulated, with a low in G1/S, an increase during G2 and M. Expression decreases again after M phase.1 Publication

Gene expression databases

BgeeiENSG00000178999.
CleanExiHS_AIM1.
HS_AURKB.
ExpressionAtlasiQ96GD4. baseline and differential.
GenevisibleiQ96GD4. HS.

Organism-specific databases

HPAiCAB005862.
HPA037708.

Interactioni

Subunit structurei

Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB and AURKC. Associates with RACGAP1 during M phase. Interacts with CDCA1, EVI5, JTB, NDC80, PSMA3, SEPT1, SIRT2 and TACC1. Interacts with SPDYC; this interaction may be required for proper localization of active, Thr-232-phosphorylated AURKB form during prometaphase and metaphase. Interacts with p53/TP53. Interacts (via the middle kinase domain) with NOC2L (via the N- and C-terminus domains). Interacts with TTC28. Interacts with RNF2/RING1B.18 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
BIRC5O153927EBI-624291,EBI-518823
BIRC5O15392-12EBI-624291,EBI-518838
BIRC5O15392-22EBI-624291,EBI-518842
CDC37Q165432EBI-624291,EBI-295634
GAS2L3Q86XJ14EBI-624291,EBI-9248152
HSP90AB1P082382EBI-624291,EBI-352572
INCENPQ9NQS77EBI-624291,EBI-307907
NPM1P067485EBI-624291,EBI-78579
SEPT1Q8WYJ66EBI-624291,EBI-693002
TACC1O75410-62EBI-624291,EBI-624278

Protein-protein interaction databases

BioGridi114646. 157 interactions.
DIPiDIP-34530N.
IntActiQ96GD4. 44 interactions.
MINTiMINT-1413997.
STRINGi9606.ENSP00000463999.

Chemistry

BindingDBiQ96GD4.

Structurei

Secondary structure

1
344
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi74 – 763Combined sources
Beta strandi77 – 826Combined sources
Beta strandi89 – 968Combined sources
Turni97 – 993Combined sources
Beta strandi102 – 1098Combined sources
Helixi110 – 1167Combined sources
Helixi119 – 13012Combined sources
Beta strandi140 – 1456Combined sources
Beta strandi147 – 1559Combined sources
Helixi162 – 1698Combined sources
Helixi174 – 19320Combined sources
Helixi203 – 2053Combined sources
Beta strandi206 – 2083Combined sources
Beta strandi214 – 2163Combined sources
Helixi242 – 2454Combined sources
Helixi253 – 26816Combined sources
Helixi278 – 2869Combined sources
Helixi298 – 30710Combined sources
Helixi312 – 3143Combined sources
Helixi318 – 3225Combined sources
Helixi325 – 3306Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4AF3X-ray2.75A55-344[»]
ProteinModelPortaliQ96GD4.
SMRiQ96GD4. Positions 32-338.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini77 – 327251Protein kinasePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily.PROSITE-ProRule annotation
Contains 1 protein kinase domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiKOG0580. Eukaryota.
ENOG410XNRB. LUCA.
GeneTreeiENSGT00770000120530.
HOVERGENiHBG108519.
InParanoidiQ96GD4.
KOiK11479.
OMAiTPNILTR.
OrthoDBiEOG091G0EU2.
PhylomeDBiQ96GD4.
TreeFamiTF351439.

Family and domain databases

InterProiIPR030616. Aur.
IPR028772. AURKB.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PANTHERiPTHR24350. PTHR24350. 1 hit.
PTHR24350:SF4. PTHR24350:SF4. 1 hit.
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96GD4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAQKENSYPW PYGRQTAPSG LSTLPQRVLR KEPVTPSALV LMSRSNVQPT
60 70 80 90 100
AAPGQKVMEN SSGTPDILTR HFTIDDFEIG RPLGKGKFGN VYLAREKKSH
110 120 130 140 150
FIVALKVLFK SQIEKEGVEH QLRREIEIQA HLHHPNILRL YNYFYDRRRI
160 170 180 190 200
YLILEYAPRG ELYKELQKSC TFDEQRTATI MEELADALMY CHGKKVIHRD
210 220 230 240 250
IKPENLLLGL KGELKIADFG WSVHAPSLRR KTMCGTLDYL PPEMIEGRMH
260 270 280 290 300
NEKVDLWCIG VLCYELLVGN PPFESASHNE TYRRIVKVDL KFPASVPMGA
310 320 330 340
QDLISKLLRH NPSERLPLAQ VSAHPWVRAN SRRVLPPSAL QSVA
Length:344
Mass (Da):39,311
Last modified:January 11, 2011 - v3
Checksum:iA5ED13EF5A1FAFBF
GO
Isoform 2 (identifier: Q96GD4-2) [UniParc]FASTAAdd to basket
Also known as: aurkb-sv1

The sequence of this isoform differs from the canonical sequence as follows:
     86-134: GKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHH → ALLCLWPEASSVSSPSH

Show »
Length:312
Mass (Da):35,302
Checksum:i9499DAE479793112
GO
Isoform 3 (identifier: Q96GD4-3) [UniParc]FASTAAdd to basket
Also known as: aurkb-sv2

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: T → TR
     133-141: HHPNILRLY → QSWRSWQML
     142-344: Missing.

Note: Not expressed in normal liver, high expression in metastatic liver.
Show »
Length:142
Mass (Da):16,211
Checksum:iD8AB62DA2CCFA385
GO
Isoform 4 (identifier: Q96GD4-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: Missing.

Show »
Length:303
Mass (Da):34,760
Checksum:i301BAFF2494B3650
GO
Isoform 5 (identifier: Q96GD4-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-69: T → TR

Show »
Length:345
Mass (Da):39,467
Checksum:iACB05C191F35F38C
GO

Sequence cautioni

The sequence AAH13300 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti14 – 152RQ → DK in AAC98891 (Ref. 5) Curated
Sequence conflicti161 – 1611E → M in AAB65786 (PubMed:11471245).Curated
Sequence conflicti161 – 1611E → M in AAC98891 (Ref. 5) Curated
Sequence conflicti167 – 1693QKS → HKT in AAB65786 (PubMed:11471245).Curated
Sequence conflicti179 – 1791T → TVRR in AAB65786 (PubMed:11471245).Curated
Sequence conflicti180 – 1801I → VRAV in AAC98891 (Ref. 5) Curated
Sequence conflicti226 – 2261P → T in BAA82709 (PubMed:9858806).Curated
Sequence conflicti249 – 2502MH → ID in BAA82709 (PubMed:9858806).Curated
Sequence conflicti271 – 2711Missing in BAA82709 (PubMed:9858806).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti52 – 521A → V.1 Publication
Corresponds to variant rs55878091 [ dbSNP | Ensembl ].
VAR_040383
Natural varianti100 – 1001H → Q.
Corresponds to variant rs3027254 [ dbSNP | Ensembl ].
VAR_027970
Natural varianti179 – 1791T → M.1 Publication
Corresponds to variant rs55871613 [ dbSNP | Ensembl ].
VAR_040384
Natural varianti298 – 2981M → T.8 Publications
Corresponds to variant rs1059476 [ dbSNP | Ensembl ].
VAR_027971

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141Missing in isoform 4. 1 PublicationVSP_047103Add
BLAST
Alternative sequencei69 – 691T → TR in isoform 3 and isoform 5. 2 PublicationsVSP_044384
Alternative sequencei86 – 13449GKFGN…AHLHH → ALLCLWPEASSVSSPSH in isoform 2. 1 PublicationVSP_044385Add
BLAST
Alternative sequencei133 – 1419HHPNILRLY → QSWRSWQML in isoform 3. 1 PublicationVSP_044386
Alternative sequencei142 – 344203Missing in isoform 3. 1 PublicationVSP_044387Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008552 mRNA. Translation: AAC12709.1.
AB011450 mRNA. Translation: BAA32136.1.
AB011446 mRNA. Translation: BAA82709.1.
AF004022 mRNA. Translation: AAB65786.1.
AF015254 mRNA. Translation: AAC98891.1.
AB519677 mRNA. Translation: BAI23190.1.
AB519678 mRNA. Translation: BAI23191.1.
AB519679 mRNA. Translation: BAI23192.1.
BT019534 mRNA. Translation: AAV38341.1.
AK297976 mRNA. Translation: BAG60286.1.
AC135178 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90075.1.
CH471108 Genomic DNA. Translation: EAW90077.1.
CH471108 Genomic DNA. Translation: EAW90078.1.
BC000442 mRNA. Translation: AAH00442.3.
BC009751 mRNA. Translation: AAH09751.1.
BC013300 mRNA. Translation: AAH13300.2. Different initiation.
BC080581 mRNA. Translation: AAH80581.1.
CCDSiCCDS11134.1. [Q96GD4-1]
CCDS58514.1. [Q96GD4-4]
CCDS67162.1. [Q96GD4-5]
RefSeqiNP_001243763.1. NM_001256834.2. [Q96GD4-4]
NP_001271455.1. NM_001284526.1. [Q96GD4-5]
NP_001300879.1. NM_001313950.1. [Q96GD4-1]
NP_001300880.1. NM_001313951.1. [Q96GD4-4]
NP_001300881.1. NM_001313952.1.
NP_001300882.1. NM_001313953.1. [Q96GD4-2]
NP_001300883.1. NM_001313954.1.
NP_001300884.1. NM_001313955.1.
NP_004208.2. NM_004217.3. [Q96GD4-1]
XP_011522372.1. XM_011524070.2. [Q96GD4-2]
XP_011522374.1. XM_011524072.2. [Q96GD4-4]
UniGeneiHs.442658.

Genome annotation databases

EnsembliENST00000316199; ENSP00000313950; ENSG00000178999. [Q96GD4-5]
ENST00000534871; ENSP00000443869; ENSG00000178999. [Q96GD4-4]
ENST00000578549; ENSP00000462207; ENSG00000178999. [Q96GD4-2]
ENST00000585124; ENSP00000463999; ENSG00000178999. [Q96GD4-1]
GeneIDi9212.
KEGGihsa:9212.
UCSCiuc002gkm.5. human. [Q96GD4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF008552 mRNA. Translation: AAC12709.1.
AB011450 mRNA. Translation: BAA32136.1.
AB011446 mRNA. Translation: BAA82709.1.
AF004022 mRNA. Translation: AAB65786.1.
AF015254 mRNA. Translation: AAC98891.1.
AB519677 mRNA. Translation: BAI23190.1.
AB519678 mRNA. Translation: BAI23191.1.
AB519679 mRNA. Translation: BAI23192.1.
BT019534 mRNA. Translation: AAV38341.1.
AK297976 mRNA. Translation: BAG60286.1.
AC135178 Genomic DNA. No translation available.
CH471108 Genomic DNA. Translation: EAW90075.1.
CH471108 Genomic DNA. Translation: EAW90077.1.
CH471108 Genomic DNA. Translation: EAW90078.1.
BC000442 mRNA. Translation: AAH00442.3.
BC009751 mRNA. Translation: AAH09751.1.
BC013300 mRNA. Translation: AAH13300.2. Different initiation.
BC080581 mRNA. Translation: AAH80581.1.
CCDSiCCDS11134.1. [Q96GD4-1]
CCDS58514.1. [Q96GD4-4]
CCDS67162.1. [Q96GD4-5]
RefSeqiNP_001243763.1. NM_001256834.2. [Q96GD4-4]
NP_001271455.1. NM_001284526.1. [Q96GD4-5]
NP_001300879.1. NM_001313950.1. [Q96GD4-1]
NP_001300880.1. NM_001313951.1. [Q96GD4-4]
NP_001300881.1. NM_001313952.1.
NP_001300882.1. NM_001313953.1. [Q96GD4-2]
NP_001300883.1. NM_001313954.1.
NP_001300884.1. NM_001313955.1.
NP_004208.2. NM_004217.3. [Q96GD4-1]
XP_011522372.1. XM_011524070.2. [Q96GD4-2]
XP_011522374.1. XM_011524072.2. [Q96GD4-4]
UniGeneiHs.442658.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4AF3X-ray2.75A55-344[»]
ProteinModelPortaliQ96GD4.
SMRiQ96GD4. Positions 32-338.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi114646. 157 interactions.
DIPiDIP-34530N.
IntActiQ96GD4. 44 interactions.
MINTiMINT-1413997.
STRINGi9606.ENSP00000463999.

Chemistry

BindingDBiQ96GD4.
ChEMBLiCHEMBL3430911.
GuidetoPHARMACOLOGYi1937.

PTM databases

iPTMnetiQ96GD4.
PhosphoSiteiQ96GD4.
SwissPalmiQ96GD4.

Polymorphism and mutation databases

BioMutaiAURKB.
DMDMi317373473.

Proteomic databases

EPDiQ96GD4.
MaxQBiQ96GD4.
PaxDbiQ96GD4.
PeptideAtlasiQ96GD4.
PRIDEiQ96GD4.

Protocols and materials databases

DNASUi9212.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000316199; ENSP00000313950; ENSG00000178999. [Q96GD4-5]
ENST00000534871; ENSP00000443869; ENSG00000178999. [Q96GD4-4]
ENST00000578549; ENSP00000462207; ENSG00000178999. [Q96GD4-2]
ENST00000585124; ENSP00000463999; ENSG00000178999. [Q96GD4-1]
GeneIDi9212.
KEGGihsa:9212.
UCSCiuc002gkm.5. human. [Q96GD4-1]

Organism-specific databases

CTDi9212.
GeneCardsiAURKB.
H-InvDBHIX0019005.
HGNCiHGNC:11390. AURKB.
HPAiCAB005862.
HPA037708.
MIMi604970. gene.
neXtProtiNX_Q96GD4.
PharmGKBiPA36199.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0580. Eukaryota.
ENOG410XNRB. LUCA.
GeneTreeiENSGT00770000120530.
HOVERGENiHBG108519.
InParanoidiQ96GD4.
KOiK11479.
OMAiTPNILTR.
OrthoDBiEOG091G0EU2.
PhylomeDBiQ96GD4.
TreeFamiTF351439.

Enzyme and pathway databases

ReactomeiR-HSA-174178. APC/C:Cdh1 mediated degradation of Cdc20 and other APC/C:Cdh1 targeted proteins in late mitosis/early G1.
R-HSA-2467813. Separation of Sister Chromatids.
R-HSA-2500257. Resolution of Sister Chromatid Cohesion.
R-HSA-4615885. SUMOylation of DNA replication proteins.
R-HSA-5663220. RHO GTPases Activate Formins.
R-HSA-6804756. Regulation of TP53 Activity through Phosphorylation.
R-HSA-68877. Mitotic Prometaphase.
SignaLinkiQ96GD4.
SIGNORiQ96GD4.

Miscellaneous databases

GeneWikiiAurora_B_kinase.
GenomeRNAii9212.
PROiQ96GD4.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000178999.
CleanExiHS_AIM1.
HS_AURKB.
ExpressionAtlasiQ96GD4. baseline and differential.
GenevisibleiQ96GD4. HS.

Family and domain databases

InterProiIPR030616. Aur.
IPR028772. AURKB.
IPR011009. Kinase-like_dom.
IPR000719. Prot_kinase_dom.
IPR017441. Protein_kinase_ATP_BS.
IPR008271. Ser/Thr_kinase_AS.
[Graphical view]
PANTHERiPTHR24350. PTHR24350. 1 hit.
PTHR24350:SF4. PTHR24350:SF4. 1 hit.
PfamiPF00069. Pkinase. 1 hit.
[Graphical view]
SMARTiSM00220. S_TKc. 1 hit.
[Graphical view]
SUPFAMiSSF56112. SSF56112. 1 hit.
PROSITEiPS00107. PROTEIN_KINASE_ATP. 1 hit.
PS50011. PROTEIN_KINASE_DOM. 1 hit.
PS00108. PROTEIN_KINASE_ST. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiAURKB_HUMAN
AccessioniPrimary (citable) accession number: Q96GD4
Secondary accession number(s): B4DNM4
, C7G533, C7G534, C7G535, D3DTR4, J9JID1, O14630, O60446, O95083, Q96DV5, Q9UQ46
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 17, 2003
Last sequence update: January 11, 2011
Last modified: September 7, 2016
This is version 182 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.