Q96GD4 (AURKB_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 145.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Aurora kinase B EC=2.7.11.1 Alternative name(s): Aurora 1 Aurora- and IPL1-like midbody-associated protein 1 Short name=AIM-1 Aurora/IPL1-related kinase 2 Short name=ARK-2 Short name=Aurora-related kinase 2 STK-1 Serine/threonine-protein kinase 12 Serine/threonine-protein kinase 5 Serine/threonine-protein kinase aurora-B | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 344 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Involved in the bipolar attachment of spindle microtubules to kinetochores and is a key regulator for the onset of cytokinesis during mitosis. Required for central/midzone spindle assembly and cleavage furrow formation. AURKB phosphorylates the CPC complex subunits BIRC5/survivin, CDCA8/borealin and INCENP. Phosphorylation of INCENP leads to increased AURKB activity. Other known AURKB substrates involved in centromeric functions and mitosis are CENPA, DES/desmin, GPAF, KIF2C, NSUN2, RACGAP1, SEPT1, VIM/vimentin, GSG2/Haspin, and histone H3. A positive feedback loop involving GSG2 and AURKB contributes to localization of CPC to centromeres. Phosphorylation of VIM controls vimentin filament segregation in cytokinetic process, whereas histone H3 is phosphorylated at 'Ser-10' and 'Ser-28' during mitosis. A positive feedback between GSG2 and AURKB contributes to CPC localization. AURKB is also required for kinetochore localization of BUB1 and SGOL1. Phosphorylation of p53/TP53 negatively regulates its transcriptional activity. Ref.11 Ref.12 Ref.14 Ref.15 Ref.16 Ref.17 Ref.18 Ref.19 Ref.21 Ref.22 Ref.23 Ref.24 Ref.25 Ref.28 Ref.30 Ref.41 Ref.42 |
| Catalytic activity | ATP + a protein = ADP + a phosphoprotein. |
| Cofactor | Magnesium. |
| Enzyme regulation | Activity is greatly increased when AURKB is within the CPC complex. In particular, AURKB-phosphorylated INCENP acts as an activator of AURKB. Positive feedback between GSG2 and AURKB contributes to CPC localization. Ref.19 Ref.22 Ref.24 |
| Subunit structure | Component of the chromosomal passenger complex (CPC) composed of at least BIRC5/survivin, CDCA8/borealin, INCENP, AURKB and AURKC. Associates with RACGAP1 during M phase. Interacts with CDCA1, EVI5, JTB, NDC80, PSMA3, SEPT1 and TACC1. Interacts with SPDYC; this interaction may be required for proper localization of active, Thr-232-phosphorylated AURKB form during prometaphase and metaphase. Interacts with p53/TP53. Interacts (via the middle kinase domain) with NOC2L (via the N- and C-terminus domains). Interacts with TTC28. Ref.11 Ref.16 Ref.19 Ref.20 Ref.22 Ref.24 Ref.25 Ref.26 Ref.27 Ref.29 Ref.33 Ref.37 Ref.38 Ref.42 Ref.43 Ref.44 |
| Subcellular location | Nucleus. Chromosome. Chromosome › centromere. Cytoplasm › cytoskeleton › spindle. Note: Localizes on chromosome arms and inner centromeres from prophase through metaphase and then transferring to the spindle midzone and midbody from anaphase through cytokinesis. Colocalized with gamma tubulin in the mid-body. Proper localization of the active, Thr-232-phosphorylated form during metaphase may be dependent upon interaction with SPDYC. Ref.11 Ref.12 Ref.17 Ref.19 Ref.27 Ref.37 Ref.42 Ref.44 |
| Tissue specificity | High level expression seen in the thymus. It is also expressed in the spleen, lung, testis, colon, placenta and fetal liver. Expressed during S and G2/M phase and expression is up-regulated in cancer cells during M phase. Ref.2 Ref.3 |
| Induction | Expression is cell cycle-regulated, with a low in G1/S, an increase during G2 and M. Expression decreases again after M phase. Ref.19 Ref.22 Ref.24 |
| Post-translational modification | The phosphorylation of Thr-232 requires the binding to INCENP and occurs by means of an autophosphorylation mechanism. Thr-232 phosphorylation is indispensable for the AURKB kinase activity. Ubiquitinated by different BCR (BTB-CUL3-RBX1) E3 ubiquitin ligase complexes. Ubiquitinated by the BCR(KLHL9-KLHL13) E3 ubiquitin ligase complex, ubiquitination leads to removal from mitotic chromosomes and is required for cytokinesis. During anaphase, the BCR(KLHL21) E3 ubiquitin ligase complex recruits the CPC complex from chromosomes to the spindle midzone and mediates the ubiquitination of AURKB. Ubiquitination of AURKB by BCR(KLHL21) E3 ubiquitin ligase complex may not lead to its degradation by the proteasome. Ref.31 Ref.35 |
| Involvement in disease | Disruptive regulation of expression is a possible mechanism of the perturbation of chromosomal integrity in cancer cells through its dominant-negative effect on cytokinesis. |
| Sequence similarities | Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. Aurora subfamily. Contains 1 protein kinase domain. |
| Sequence caution | The sequence AAH13300.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BIRC5 | O15392 | 2 | EBI-624291,EBI-518823 | |
| BIRC5 | O15392-1 | 2 | EBI-624291,EBI-518838 | |
| BIRC5 | O15392-2 | 2 | EBI-624291,EBI-518842 | |
| HSP90AB1 | P08238 | 2 | EBI-624291,EBI-352572 | |
| INCENP | Q9NQS7 | 3 | EBI-624291,EBI-307907 | |
| SEPT1 | Q8WYJ6 | 6 | EBI-624291,EBI-693002 | |
| TACC1 | O75410-6 | 2 | EBI-624291,EBI-624278 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96GD4-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96GD4-2) Also known as: aurkb-sv1; The sequence of this isoform differs from the canonical sequence as follows: 86-134: GKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEHQLRREIEIQAHLHH → ALLCLWPEASSVSSPSH | ||||||
| Isoform 3 (identifier: Q96GD4-3) Also known as: aurkb-sv2; The sequence of this isoform differs from the canonical sequence as follows: 69-69: T → TR 133-141: HHPNILRLY → QSWRSWQML 142-344: Missing. | ||||||
| Note: Not expressed in normal liver, high expression in metastatic liver. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 344 | 344 | Aurora kinase B | PRO_0000085656 | |||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 77 – 327 | 251 | Protein kinase | ||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 83 – 91 | 9 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 200 | 1 | Proton acceptor By similarity | ||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 106 | 1 | ATP By similarity | ||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 35 | 1 | Phosphothreonine Ref.34 | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 62 | 1 | Phosphoserine Ref.39 | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 64 | 1 | Phosphothreonine Ref.39 | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 232 | 1 | Phosphothreonine; by autocatalysis Ref.22 | ||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 69 | 1 | T → TR in isoform 3. | VSP_044384 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 86 – 134 | 49 | GKFGN…AHLHH → ALLCLWPEASSVSSPSH in isoform 2. | VSP_044385 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 133 – 141 | 9 | HHPNILRLY → QSWRSWQML in isoform 3. | VSP_044386 | |||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 142 – 344 | 203 | Missing in isoform 3. | VSP_044387 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 52 | 1 | A → V. Ref.46 | VAR_040383 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 100 | 1 | H → Q. Corresponds to variant rs3027254 [ dbSNP | Ensembl ]. | VAR_027970 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 179 | 1 | T → M. Ref.46 | VAR_040384 | |||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 298 | 1 | M → T. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.7 Ref.10 Ref.45 Corresponds to variant rs1059476 [ dbSNP | Ensembl ]. | VAR_027971 | |||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 106 | 1 | K → R: Leads to loss of kinase activity and severely impairs mitotic progression. Ref.18 Ref.19 Ref.22 Ref.27 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 14 – 15 | 2 | RQ → DK in AAC98891. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 70 | 1 | R → RR in AAH13300. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 161 | 1 | E → M in AAB65786. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 161 | 1 | E → M in AAC98891. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 167 – 169 | 3 | QKS → HKT in AAB65786. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 179 | 1 | T → TVRR in AAB65786. Ref.4 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 180 | 1 | I → VRAV in AAC98891. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 226 | 1 | P → T in BAA82709. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 249 – 250 | 2 | MH → ID in BAA82709. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 271 | 1 | Missing in BAA82709. Ref.3 | ||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 74 – 76 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 77 – 82 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 89 – 96 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Turn | 97 – 99 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 109 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 116 | 7 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 119 – 130 | 12 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 140 – 145 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 147 – 155 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 162 – 169 | 8 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 174 – 193 | 20 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 203 – 205 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 206 – 208 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 214 – 216 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 242 – 245 | 4 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 253 – 268 | 16 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 278 – 286 | 9 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 298 – 307 | 10 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 312 – 314 | 3 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 318 – 322 | 5 | |||||||||||||||||||||||||||||||||||||||||||||
| Helix | 325 – 330 | 6 | |||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning, expression, subcellular localization, and chromosomal assignment of mammalian aurora homologues, aurora-related kinase (ARK) 1 and 2." Shindo M., Nakano H., Kuroyanagi H., Shirasawa T., Mihara M., Gilbert D.J., Jenkins N.A., Copeland N.G., Yagita H., Okumura K. Biochem. Biophys. Res. Commun. 244:285-292(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-298. |
| [2] | "Multinuclearity and increased ploidy caused by overexpression of the aurora- and Ipl1-like midbody-associated protein mitotic kinase in human cancer cells." Tatsuka M., Katayama H., Ota T., Tanaka T., Odashima S., Suzuki F., Terada Y. Cancer Res. 58:4811-4816(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-298. |
| [3] | "Identification and characterization of STK12/Aik2: a human gene related to aurora of Drosophila and yeast IPL1." Kimura M., Matsuda Y., Yoshioka T., Sumi N., Okano Y. Cytogenet. Cell Genet. 82:147-152(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, VARIANT THR-298. Tissue: Liver and Spleen. |
| [4] | "In silico cloning of a new protein kinase, Aik2, related to Drosophila aurora using the new tool: EST Blast." Prigent C., Gill R., Trower M., Sanseau P. In Silico Biol. 1:123-128(1999) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-298. |
| [5] | "Cloning of a novel human gene homologous to mouse STK-1." Zhang Q., Yu L., Bi A. Submitted (JUL-1997) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT THR-298. |
| [6] | "Expression of Aurora B and alternative variant forms in hepatocellular carcinoma and adjacent tissue." Yasen M., Mizushima H., Mogushi K., Obulhasim G., Miyaguchi K., Inoue K., Nakahara I., Ohta T., Aihara A., Tanaka S., Arii S., Tanaka H. Cancer Sci. 100:472-480(2009) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 3), ALTERNATIVE SPLICING. |
| [7] | "Cloning of human full-length CDSs in BD Creator(TM) system donor vector." Kalnine N., Chen X., Rolfs A., Halleck A., Hines L., Eisenstein S., Koundinya M., Raphael J., Moreira D., Kelley T., LaBaer J., Lin Y., Phelan M., Farmer A. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-298. |
| [8] | "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage." Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L. Nusbaum C.Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT THR-298. Tissue: Lung, Lymph and Muscle. |
| [11] | "INCENP is required for proper targeting of Survivin to the centromeres and the anaphase spindle during mitosis." Wheatley S.P., Carvalho A., Vagnarelli P., Earnshaw W.C. Curr. Biol. 11:886-890(2001) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE CPC COMPLEX, SUBCELLULAR LOCATION, FUNCTION. |
| [12] | "CENP-A is phosphorylated by Aurora B kinase and plays an unexpected role in completion of cytokinesis." Zeitlin S.G., Shelby R.D., Sullivan K.F. J. Cell Biol. 155:1147-1157(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [13] | "Mitotic kinases as regulators of cell division and its checkpoints." Nigg E.A. Nat. Rev. Mol. Cell Biol. 2:21-32(2001) [PubMed] [Europe PMC] [Abstract] Cited for: REVIEW. |
| [14] | "Aurora-B phosphorylates Histone H3 at serine28 with regard to the mitotic chromosome condensation." Goto H., Yasui Y., Nigg E.A., Inagaki M. Genes Cells 7:11-17(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF HISTONE H3. |
| [15] | "Mitotic phosphorylation of histone H3: spatio-temporal regulation by mammalian Aurora kinases." Crosio C., Fimia G.M., Loury R., Kimura M., Okano Y., Zhou H., Sen S., Allis C.D., Sassone-Corsi P. Mol. Cell. Biol. 22:874-885(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF HISTONE H3. |
| [16] | "Phosphorylation by aurora B converts MgcRacGAP to a RhoGAP during cytokinesis." Minoshima Y., Kawashima T., Hirose K., Tonozuka Y., Kawajiri A., Bao Y.C., Deng X., Tatsuka M., Narumiya S., May W.S. Jr., Nosaka T., Semba K., Inoue T., Satoh T., Inagaki M., Kitamura T. Dev. Cell 4:549-560(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH RACGAP1. |
| [17] | "Aurora-B regulates the cleavage furrow-specific vimentin phosphorylation in the cytokinetic process." Goto H., Yasui Y., Kawajiri A., Nigg E.A., Terada Y., Tatsuka M., Nagata K., Inagaki M. J. Biol. Chem. 278:8526-8530(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [18] | "Functional significance of the specific sites phosphorylated in desmin at cleavage furrow: Aurora-B may phosphorylate and regulate type III intermediate filaments during cytokinesis coordinatedly with Rho-kinase." Kawajiri A., Yasui Y., Goto H., Tatsuka M., Takahashi M., Nagata K., Inagaki M. Mol. Biol. Cell 14:1489-1500(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF LYS-106. |
| [19] | "Exploring the functional interactions between Aurora B, INCENP, and survivin in mitosis." Honda R., Korner R., Nigg E.A. Mol. Biol. Cell 14:3325-3341(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE CPC COMPLEX, FUNCTION OF THE CPC COMPLEX, INDUCTION, SUBCELLULAR LOCATION, ENZYME REGULATION, MUTAGENESIS OF LYS-106. |
| [20] | "Human Aurora-B binds to a proteasome alpha-subunit HC8 and undergoes degradation in a proteasome-dependent manner." Shu F., Guo S., Dang Y., Qi M., Zhou G., Guo Z., Zhang Y., Wu C., Zhao S., Yu L. Mol. Cell. Biochem. 254:157-162(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PSMA3. |
| [21] | "Aurora-B phosphorylation in vitro identifies a residue of survivin that is essential for its localization and binding to inner centromere protein (INCENP) in vivo." Wheatley S.P., Henzing A.J., Dodson H., Khaled W., Earnshaw W.C. J. Biol. Chem. 279:5655-5660(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [22] | "Autophosphorylation of a newly identified site of Aurora-B is indispensable for cytokinesis." Yasui Y., Urano T., Kawajiri A., Nagata K., Tatsuka M., Saya H., Furukawa K., Takahashi T., Izawa I., Inagaki M. J. Biol. Chem. 279:12997-13003(2004) [PubMed] [Europe PMC] [Abstract] Cited for: AUTOPHOSPHORYLATION AT THR-232, FUNCTION, INTERACTION WITH INCENP, ENZYME REGULATION, MUTAGENESIS OF LYS-106. |
| [23] | "Bub1 is required for kinetochore localization of BubR1, Cenp-E, Cenp-F and Mad2, and chromosome congression." Johnson V.L., Scott M.I., Holt S.V., Hussein D., Taylor S.S. J. Cell Sci. 117:1577-1589(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [24] | "Borealin: a novel chromosomal passenger required for stability of the bipolar mitotic spindle." Gassmann R., Carvalho A., Henzing A.J., Ruchaud S., Hudson D.F., Honda R., Nigg E.A., Gerloff D.L., Earnshaw W.C. J. Cell Biol. 166:179-191(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CDCA8, ENZYME REGULATION, FUNCTION. |
| [25] | "Identification of the substrates and interaction proteins of aurora kinases from a protein-protein interaction model." Tien A.-C., Lin M.-H., Su L.-J., Hong Y.-R., Cheng T.-S., Lee Y.-C.G., Lin W.-J., Still I.H., Huang C.-Y.F. Mol. Cell. Proteomics 3:93-104(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH CDCA1 AND NDC80. |
| [26] | "Aurora B -TACC1 protein complex in cytokinesis." Delaval B., Ferrand A., Conte N., Larroque C., Hernandez-Verdun D., Prigent C., Birnbaum D. Oncogene 23:4516-4522(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TACC1. |
| [27] | "Septin1, a new interaction partner for human serine/threonine kinase aurora-B." Qi M., Yu W., Liu S., Jia H., Tang L., Shen M., Yan X., Saiyin H., Lang Q., Wan B., Zhao S., Yu L. Biochem. Biophys. Res. Commun. 336:994-1000(2005) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH SEPT1, MUTAGENESIS OF LYS-106. |
| [28] | "An ECT2-centralspindlin complex regulates the localization and function of RhoA." Yuce O., Piekny A., Glotzer M. J. Cell Biol. 170:571-582(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [29] | "EVI5 protein associates with the INCENP-aurora B kinase-survivin chromosomal passenger complex and is involved in the completion of cytokinesis." Faitar S.L., Sossey-Alaoui K., Ranalli T.A., Cowell J.K. Exp. Cell Res. 312:2325-2335(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH EVI5. |
| [30] | "Shugoshin 1 plays a central role in kinetochore assembly and is required for kinetochore targeting of Plk1." Pouwels J., Kukkonen A.M., Lan W., Daum J.R., Gorbsky G.J., Stukenberg T., Kallio M.J. Cell Cycle 6:1579-1585(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [31] | "A Cul3-based E3 ligase removes Aurora B from mitotic chromosomes, regulating mitotic progression and completion of cytokinesis in human cells." Sumara I., Quadroni M., Frei C., Olma M.H., Sumara G., Ricci R., Peter M. Dev. Cell 12:887-900(2007) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION. |
| [32] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [33] | "A survivin-ran complex regulates spindle formation in tumor cells." Xia F., Canovas P.M., Guadagno T.M., Altieri D.C. Mol. Cell. Biol. 28:5299-5311(2008) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BIRC5. |
| [34] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-35, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [35] | "The Cul3-KLHL21 E3 ubiquitin ligase targets aurora B to midzone microtubules in anaphase and is required for cytokinesis." Maerki S., Olma M.H., Staubli T., Steigemann P., Gerlich D.W., Quadroni M., Sumara I., Peter M. J. Cell Biol. 187:791-800(2009) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION. |
| [36] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [37] | "RINGO C is required to sustain the spindle-assembly checkpoint." Mouron S., de Carcer G., Seco E., Fernandez-Miranda G., Malumbres M., Nebreda A.R. J. Cell Sci. 123:2586-2595(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SPDYC, SUBCELLULAR LOCATION. |
| [38] | "Human POGZ modulates dissociation of HP1alpha from mitotic chromosome arms through Aurora B activation." Nozawa R.S., Nagao K., Masuda H.T., Iwasaki O., Hirota T., Nozaki N., Kimura H., Obuse C. Nat. Cell Biol. 12:719-727(2010) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH INCENP. |
| [39] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-62 AND THR-64, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [40] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [41] | "A positive feedback loop involving Haspin and Aurora B promotes CPC accumulation at centromeres in mitosis." Wang F., Ulyanova N.P., van der Waal M.S., Patnaik D., Lens S.M., Higgins J.M. Curr. Biol. 21:1061-1069(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF GSG2. |
| [42] | "Aurora B interacts with NIR-p53, leading to p53 phosphorylation in its DNA-binding domain and subsequent functional suppression." Wu L., Ma C.A., Zhao Y., Jain A. J. Biol. Chem. 286:2236-2244(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN PHOSPHORYLATION OF TP53, INTERACTION WITH NOC2L AND TP53, SUBCELLULAR LOCATION. |
| [43] | "PAR, a protein involved in the cell cycle, is functionally related to chromosomal passenger proteins." Platica M., Ionescu A., Ivan E., Holland J.F., Mandeli J., Platica O. Int. J. Oncol. 38:777-785(2011) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH JTB. |
| [44] | "A novel big protein TPRBK possessing 25 units of TPR motif is essential for the progress of mitosis and cytokinesis." Izumiyama T., Minoshima S., Yoshida T., Shimizu N. Gene 511:202-217(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TTC28, SUBCELLULAR LOCATION. |
| [45] | "Aurora kinases A and B and familial breast cancer risk." Tchatchou S., Wirtenberger M., Hemminki K., Sutter C., Meindl A., Wappenschmidt B., Kiechle M., Bugert P., Schmutzler R.K., Bartram C.R., Burwinkel B. Cancer Lett. 247:266-272(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT THR-298. |
| [46] | "Patterns of somatic mutation in human cancer genomes." Greenman C., Stephens P., Smith R., Dalgliesh G.L., Hunter C., Bignell G., Davies H., Teague J., Butler A., Stevens C., Edkins S., O'Meara S., Vastrik I., Schmidt E.E., Avis T., Barthorpe S., Bhamra G., Buck G. Stratton M.R.Nature 446:153-158(2007) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS [LARGE SCALE ANALYSIS] VAL-52 AND MET-179. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF008552 mRNA. Translation: AAC12709.1. AB011450 mRNA. Translation: BAA32136.1. AB011446 mRNA. Translation: BAA82709.1. AF004022 mRNA. Translation: AAB65786.1. AF015254 mRNA. Translation: AAC98891.1. AB519677 mRNA. Translation: BAI23190.1. AB519678 mRNA. Translation: BAI23191.1. AB519679 mRNA. Translation: BAI23192.1. BT019534 mRNA. Translation: AAV38341.1. AC135178 Genomic DNA. No translation available. CH471108 Genomic DNA. Translation: EAW90075.1. CH471108 Genomic DNA. Translation: EAW90077.1. CH471108 Genomic DNA. Translation: EAW90078.1. BC000442 mRNA. Translation: AAH00442.3. BC009751 mRNA. Translation: AAH09751.1. BC013300 mRNA. Translation: AAH13300.2. Different initiation. BC080581 mRNA. Translation: AAH80581.1. | ||||||||||||
| IPI | IPI00176642. IPI00946543. IPI00947382. | ||||||||||||
| RefSeq | NP_004208.2. NM_004217.3. | ||||||||||||
| UniGene | Hs.442658. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q96GD4. | ||||||||||||
| SMR | Q96GD4. Positions 70-338. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-34530N. | ||||||||||||
| IntAct | Q96GD4. 23 interactions. | ||||||||||||
| MINT | MINT-1413997. | ||||||||||||
| STRING | 9606.ENSP00000313950. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q96GD4. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 27805737. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q96GD4. | ||||||||||||
| PRIDE | Q96GD4. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 9212. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000535053; ENSP00000445866; ENSG00000178999. ENST00000578549; ENSP00000462207; ENSG00000178999. ENST00000585124; ENSP00000463999; ENSG00000178999. | ||||||||||||
| GeneID | 9212. | ||||||||||||
| KEGG | hsa:9212. | ||||||||||||
| UCSC | uc002gkm.3. human. uc021tpy.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 9212. | ||||||||||||
| GeneCards | GC17M008108. | ||||||||||||
| H-InvDB | HIX0019005. | ||||||||||||
| HGNC | HGNC:11390. AURKB. | ||||||||||||
| HPA | CAB005862. | ||||||||||||
| MIM | 604970. gene. | ||||||||||||
| neXtProt | NX_Q96GD4. | ||||||||||||
| PharmGKB | PA36199. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0515. | ||||||||||||
| HOVERGEN | HBG108519. | ||||||||||||
| InParanoid | Q96GD4. | ||||||||||||
| KO | K11479. | ||||||||||||
| OMA | VPTGAQD. | ||||||||||||
| OrthoDB | EOG4TTGJG. | ||||||||||||
| PhylomeDB | Q96GD4. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | aurora_a_pathway. Aurora A signaling. aurora_b_pathway. Aurora B signaling. aurora_c_pathway. Aurora C signaling. foxm1pathway. FOXM1 transcription factor network. aurora_kinase_pathway. Signaling by Aurora kinases. | ||||||||||||
| Reactome | REACT_115566. Cell Cycle. REACT_21300. Mitotic M-M/G1 phases. | ||||||||||||
| SignaLink | Q96GD4. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96GD4. | ||||||||||||
| Bgee | Q96GD4. | ||||||||||||
| CleanEx | HS_AIM1. HS_AURKB. | ||||||||||||
| Genevestigator | Q96GD4. | ||||||||||||
| GermOnline | ENSG00000178999. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR011009. Kinase-like_dom. IPR000719. Prot_kinase_cat_dom. IPR017441. Protein_kinase_ATP_BS. IPR002290. Ser/Thr_dual-sp_kinase_dom. IPR008271. Ser/Thr_kinase_AS. [Graphical view] | ||||||||||||
| Pfam | PF00069. Pkinase. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00220. S_TKc. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF56112. Kinase_like. 1 hit. | ||||||||||||
| PROSITE | PS00107. PROTEIN_KINASE_ATP. 1 hit. PS50011. PROTEIN_KINASE_DOM. 1 hit. PS00108. PROTEIN_KINASE_ST. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| BindingDB | Q96GD4. | ||||||||||||
| ChEMBL | CHEMBL2185. | ||||||||||||
| GenomeRNAi | 9212. | ||||||||||||
| NextBio | 34535. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | AURKB_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96GD4 Secondary accession number(s): C7G533 Q9UQ46 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human and mouse protein kinases Human and mouse protein kinases: classification and index |
| Human chromosome 17 Human chromosome 17: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
