Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Polycomb protein SCMH1

Gene

SCMH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Associates with Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes.By similarity

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • transcription factor activity, sequence-specific DNA binding Source: ProtInc

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

BioCyciZFISH:ENSG00000010803-MONOMER.
ReactomeiR-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-3108214. SUMOylation of DNA damage response and repair proteins.
R-HSA-4570464. SUMOylation of RNA binding proteins.

Names & Taxonomyi

Protein namesi
Recommended name:
Polycomb protein SCMH1
Alternative name(s):
Sex comb on midleg homolog 1
Gene namesi
Name:SCMH1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:19003. SCMH1.

Subcellular locationi

GO - Cellular componenti

  • chromocenter Source: Ensembl
  • nucleoplasm Source: Reactome
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000010803.
PharmGKBiPA134870272.

Polymorphism and mutation databases

BioMutaiSCMH1.
DMDMi60390956.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001143341 – 660Polycomb protein SCMH1Add BLAST660

Proteomic databases

MaxQBiQ96GD3.
PaxDbiQ96GD3.
PeptideAtlasiQ96GD3.
PRIDEiQ96GD3.

PTM databases

iPTMnetiQ96GD3.
PhosphoSitePlusiQ96GD3.

Expressioni

Tissue specificityi

Strongly expressed in heart, muscle and pancreas. Weakly expressed in brain, placenta, lung, liver and kidney.1 Publication

Gene expression databases

BgeeiENSG00000010803.
CleanExiHS_SCMH1.
ExpressionAtlasiQ96GD3. baseline and differential.
GenevisibleiQ96GD3. HS.

Organism-specific databases

HPAiHPA048898.
HPA053292.

Interactioni

Subunit structurei

Interacts with the SAM domain of PHC1 via its SAM domain in vitro (By similarity). Associates with a PRC1-like complex.By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
MAGEA12Q6FHH83EBI-713793,EBI-10178394
UBQLN1Q9UMX03EBI-713793,EBI-741480
UBQLN1Q9UMX0-23EBI-713793,EBI-10173939

Protein-protein interaction databases

BioGridi116609. 30 interactors.
IntActiQ96GD3. 20 interactors.
MINTiMINT-1422768.
STRINGi9606.ENSP00000318094.

Structurei

Secondary structure

1660
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi30 – 36Combined sources7
Helixi44 – 46Combined sources3
Beta strandi47 – 49Combined sources3
Beta strandi63 – 68Combined sources6
Beta strandi71 – 84Combined sources14
Beta strandi87 – 92Combined sources6
Beta strandi101 – 104Combined sources4
Helixi115 – 118Combined sources4
Helixi133 – 135Combined sources3
Helixi136 – 144Combined sources9
Helixi152 – 154Combined sources3
Beta strandi172 – 176Combined sources5
Beta strandi184 – 193Combined sources10
Beta strandi196 – 201Combined sources6
Turni205 – 208Combined sources4
Beta strandi210 – 213Combined sources4
Helixi224 – 228Combined sources5

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P0KX-ray1.75A27-238[»]
ProteinModelPortaliQ96GD3.
SMRiQ96GD3.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96GD3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati28 – 126MBT 1Add BLAST99
Repeati134 – 235MBT 2Add BLAST102
Domaini593 – 658SAMPROSITE-ProRule annotationAdd BLAST66

Sequence similaritiesi

Belongs to the SCM family.Curated
Contains 2 MBT repeats.PROSITE-ProRule annotation
Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IMEZ. Eukaryota.
ENOG410XPKI. LUCA.
GeneTreeiENSGT00760000119024.
HOGENOMiHOG000236280.
HOVERGENiHBG056406.
InParanoidiQ96GD3.
KOiK11461.
OMAiAPAHCFK.
OrthoDBiEOG091G05BW.
PhylomeDBiQ96GD3.
TreeFamiTF106488.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
InterProiIPR004092. Mbt.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR033763. SCML2_RBR.
IPR021987. SLED.
[Graphical view]
PfamiPF02820. MBT. 2 hits.
PF17208. RBR. 1 hit.
PF00536. SAM_1. 1 hit.
PF12140. SLED. 1 hit.
[Graphical view]
SMARTiSM00561. MBT. 2 hits.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
PROSITEiPS51079. MBT. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96GD3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLVCYSVLAC EILWDLPCSI MGSPLGHFTW DKYLKETCSV PAPVHCFKQS
60 70 80 90 100
YTPPSNEFKI SMKLEAQDPR NTTSTCIATV VGLTGARLRL RLDGSDNKND
110 120 130 140 150
FWRLVDSAEI QPIGNCEKNG GMLQPPLGFR LNASSWPMFL LKTLNGAEMA
160 170 180 190 200
PIRIFHKEPP SPSHNFFKMG MKLEAVDRKN PHFICPATIG EVRGSEVLVT
210 220 230 240 250
FDGWRGAFDY WCRFDSRDIF PVGWCSLTGD NLQPPGTKVV IPKNPYPASD
260 270 280 290 300
VNTEKPSIHS STKTVLEHQP GQRGRKPGKK RGRTPKTLIS HPISAPSKTA
310 320 330 340 350
EPLKFPKKRG PKPGSKRKPR TLLNPPPASP TTSTPEPDTS TVPQDAATIP
360 370 380 390 400
SSAMQAPTVC IYLNKNGSTG PHLDKKKVQQ LPDHFGPARA SVVLQQAVQA
410 420 430 440 450
CIDCAYHQKT VFSFLKQGHG GEVISAVFDR EQHTLNLPAV NSITYVLRFL
460 470 480 490 500
EKLCHNLRSD NLFGNQPFTQ THLSLTAIEY SHSHDRYLPG ETFVLGNSLA
510 520 530 540 550
RSLEPHSDSM DSASNPTNLV STSQRHRPLL SSCGLPPSTA SAVRRLCSRG
560 570 580 590 600
VLKGSNERRD MESFWKLNRS PGSDRYLESR DASRLSGRDP SSWTVEDVMQ
610 620 630 640 650
FVREADPQLG PHADLFRKHE IDGKALLLLR SDMMMKYMGL KLGPALKLSY
660
HIDRLKQGKF
Note: No experimental confirmation available.Curated
Length:660
Mass (Da):73,354
Last modified:December 1, 2001 - v1
Checksum:i6544DD484DA8D037
GO
Isoform 2 (identifier: Q96GD3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLVCYSVLACEILWDLPCSIMGSP → MQPNVIDWSDVRKHKYGHLSESASQYQEAADILD
     550-571: Missing.

Note: Gene prediction confirmed by EST data.
Show »
Length:648
Mass (Da):72,053
Checksum:i5DBA4803D9E8B3B5
GO
Isoform 3 (identifier: Q96GD3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.

Show »
Length:599
Mass (Da):66,459
Checksum:iAC9C5AB96BDF79E1
GO
Isoform 41 Publication (identifier: Q96GD3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
     550-571: Missing.

Show »
Length:591
Mass (Da):65,481
Checksum:iE5F43403878E53BA
GO
Isoform 51 Publication (identifier: Q96GD3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     550-571: Missing.

Note: May be due to intron retention.1 Publication
Show »
Length:577
Mass (Da):63,870
Checksum:i1EC4A9E8452B66F0
GO
Isoform 6 (identifier: Q96GD3-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
     128-238: Missing.
     550-571: Missing.

Note: No experimental confirmation available.
Show »
Length:480
Mass (Da):52,908
Checksum:iCCD341EBF6748EF5
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti463F → L (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0516781 – 61Missing in isoform 3 and isoform 5. 4 PublicationsAdd BLAST61
Alternative sequenceiVSP_0516771 – 48MLVCY…VHCFK → M in isoform 4 and isoform 6. 2 PublicationsAdd BLAST48
Alternative sequenceiVSP_0516761 – 24MLVCY…IMGSP → MQPNVIDWSDVRKHKYGHLS ESASQYQEAADILD in isoform 2. CuratedAdd BLAST24
Alternative sequenceiVSP_043395128 – 238Missing in isoform 6. 1 PublicationAdd BLAST111
Alternative sequenceiVSP_051679550 – 571Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsAdd BLAST22

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149045 mRNA. Translation: AAF01150.1.
AF149046 mRNA. Translation: AAF01151.1.
AK299383 mRNA. Translation: BAG61370.1.
CR457161 mRNA. Translation: CAG33442.1.
BX640721 mRNA. Translation: CAE45840.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22109.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22110.1.
AL110502, AL391730, AL606484 Genomic DNA. Translation: CAI22111.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22112.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22113.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72791.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72793.1.
AL391730, AL110502, AL606484 Genomic DNA. Translation: CAH72794.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72795.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72796.1.
AL606484, AL110502, AL391730 Genomic DNA. Translation: CAH72242.1.
BC009752 mRNA. Translation: AAH09752.1.
BC021252 mRNA. Translation: AAH21252.1.
CCDSiCCDS30688.1. [Q96GD3-1]
CCDS461.1. [Q96GD3-4]
CCDS53301.1. [Q96GD3-5]
CCDS53302.1. [Q96GD3-3]
CCDS53303.1. [Q96GD3-6]
CCDS53304.1. [Q96GD3-2]
RefSeqiNP_001026864.1. NM_001031694.2. [Q96GD3-1]
NP_001165689.1. NM_001172218.1. [Q96GD3-5]
NP_001165690.1. NM_001172219.1. [Q96GD3-2]
NP_001165691.1. NM_001172220.1. [Q96GD3-5]
NP_001165692.1. NM_001172221.1. [Q96GD3-3]
NP_001165693.1. NM_001172222.2. [Q96GD3-6]
NP_036368.1. NM_012236.3. [Q96GD3-4]
XP_006710527.1. XM_006710464.1. [Q96GD3-3]
XP_011539335.1. XM_011541033.2. [Q96GD3-1]
XP_011539338.1. XM_011541036.2. [Q96GD3-3]
XP_016856188.1. XM_017000699.1. [Q96GD3-3]
XP_016856196.1. XM_017000707.1. [Q96GD3-6]
UniGeneiHs.571874.

Genome annotation databases

EnsembliENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
ENST00000397174; ENSP00000380359; ENSG00000010803. [Q96GD3-1]
ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-3]
ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
GeneIDi22955.
KEGGihsa:22955.
UCSCiuc001cgp.4. human. [Q96GD3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF149045 mRNA. Translation: AAF01150.1.
AF149046 mRNA. Translation: AAF01151.1.
AK299383 mRNA. Translation: BAG61370.1.
CR457161 mRNA. Translation: CAG33442.1.
BX640721 mRNA. Translation: CAE45840.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22109.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22110.1.
AL110502, AL391730, AL606484 Genomic DNA. Translation: CAI22111.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22112.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22113.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72791.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72793.1.
AL391730, AL110502, AL606484 Genomic DNA. Translation: CAH72794.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72795.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72796.1.
AL606484, AL110502, AL391730 Genomic DNA. Translation: CAH72242.1.
BC009752 mRNA. Translation: AAH09752.1.
BC021252 mRNA. Translation: AAH21252.1.
CCDSiCCDS30688.1. [Q96GD3-1]
CCDS461.1. [Q96GD3-4]
CCDS53301.1. [Q96GD3-5]
CCDS53302.1. [Q96GD3-3]
CCDS53303.1. [Q96GD3-6]
CCDS53304.1. [Q96GD3-2]
RefSeqiNP_001026864.1. NM_001031694.2. [Q96GD3-1]
NP_001165689.1. NM_001172218.1. [Q96GD3-5]
NP_001165690.1. NM_001172219.1. [Q96GD3-2]
NP_001165691.1. NM_001172220.1. [Q96GD3-5]
NP_001165692.1. NM_001172221.1. [Q96GD3-3]
NP_001165693.1. NM_001172222.2. [Q96GD3-6]
NP_036368.1. NM_012236.3. [Q96GD3-4]
XP_006710527.1. XM_006710464.1. [Q96GD3-3]
XP_011539335.1. XM_011541033.2. [Q96GD3-1]
XP_011539338.1. XM_011541036.2. [Q96GD3-3]
XP_016856188.1. XM_017000699.1. [Q96GD3-3]
XP_016856196.1. XM_017000707.1. [Q96GD3-6]
UniGeneiHs.571874.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2P0KX-ray1.75A27-238[»]
ProteinModelPortaliQ96GD3.
SMRiQ96GD3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi116609. 30 interactors.
IntActiQ96GD3. 20 interactors.
MINTiMINT-1422768.
STRINGi9606.ENSP00000318094.

PTM databases

iPTMnetiQ96GD3.
PhosphoSitePlusiQ96GD3.

Polymorphism and mutation databases

BioMutaiSCMH1.
DMDMi60390956.

Proteomic databases

MaxQBiQ96GD3.
PaxDbiQ96GD3.
PeptideAtlasiQ96GD3.
PRIDEiQ96GD3.

Protocols and materials databases

DNASUi22955.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
ENST00000397174; ENSP00000380359; ENSG00000010803. [Q96GD3-1]
ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-3]
ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
GeneIDi22955.
KEGGihsa:22955.
UCSCiuc001cgp.4. human. [Q96GD3-1]

Organism-specific databases

CTDi22955.
GeneCardsiSCMH1.
HGNCiHGNC:19003. SCMH1.
HPAiHPA048898.
HPA053292.
MIMi616396. gene.
neXtProtiNX_Q96GD3.
OpenTargetsiENSG00000010803.
PharmGKBiPA134870272.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IMEZ. Eukaryota.
ENOG410XPKI. LUCA.
GeneTreeiENSGT00760000119024.
HOGENOMiHOG000236280.
HOVERGENiHBG056406.
InParanoidiQ96GD3.
KOiK11461.
OMAiAPAHCFK.
OrthoDBiEOG091G05BW.
PhylomeDBiQ96GD3.
TreeFamiTF106488.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000010803-MONOMER.
ReactomeiR-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-3108214. SUMOylation of DNA damage response and repair proteins.
R-HSA-4570464. SUMOylation of RNA binding proteins.

Miscellaneous databases

ChiTaRSiSCMH1. human.
EvolutionaryTraceiQ96GD3.
GeneWikiiSCMH1.
GenomeRNAii22955.
PROiQ96GD3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000010803.
CleanExiHS_SCMH1.
ExpressionAtlasiQ96GD3. baseline and differential.
GenevisibleiQ96GD3. HS.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
InterProiIPR004092. Mbt.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR033763. SCML2_RBR.
IPR021987. SLED.
[Graphical view]
PfamiPF02820. MBT. 2 hits.
PF17208. RBR. 1 hit.
PF00536. SAM_1. 1 hit.
PF12140. SLED. 1 hit.
[Graphical view]
SMARTiSM00561. MBT. 2 hits.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
PROSITEiPS51079. MBT. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSCMH1_HUMAN
AccessioniPrimary (citable) accession number: Q96GD3
Secondary accession number(s): B4DRQ8
, Q5VT76, Q6IAJ4, Q8WU48, Q9UKM5, Q9UKM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 136 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.