Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96GD3

- SCMH1_HUMAN

UniProt

Q96GD3 - SCMH1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Polycomb protein SCMH1

Gene

SCMH1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Associates with Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes.By similarity

GO - Molecular functioni

  1. DNA binding Source: ProtInc
  2. sequence-specific DNA binding transcription factor activity Source: ProtInc

GO - Biological processi

  1. anatomical structure morphogenesis Source: ProtInc
  2. anterior/posterior pattern specification Source: Ensembl
  3. chromatin remodeling Source: Ensembl
  4. gene silencing Source: UniProtKB
  5. negative regulation of transcription, DNA-templated Source: UniProtKB
  6. spermatogenesis Source: Ensembl
  7. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiREACT_169436. Oxidative Stress Induced Senescence.

Names & Taxonomyi

Protein namesi
Recommended name:
Polycomb protein SCMH1
Alternative name(s):
Sex comb on midleg homolog 1
Gene namesi
Name:SCMH1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:19003. SCMH1.

Subcellular locationi

Nucleus Curated

GO - Cellular componenti

  1. chromocenter Source: Ensembl
  2. nucleoplasm Source: Reactome
  3. nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134870272.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 660660Polycomb protein SCMH1PRO_0000114334Add
BLAST

Proteomic databases

MaxQBiQ96GD3.
PaxDbiQ96GD3.
PRIDEiQ96GD3.

PTM databases

PhosphoSiteiQ96GD3.

Expressioni

Tissue specificityi

Strongly expressed in heart, muscle and pancreas. Weakly expressed in brain, placenta, lung, liver and kidney.1 Publication

Gene expression databases

BgeeiQ96GD3.
CleanExiHS_SCMH1.
GenevestigatoriQ96GD3.

Organism-specific databases

HPAiHPA048898.
HPA053292.

Interactioni

Subunit structurei

Interacts with the SAM domain of PHC1 via its SAM domain in vitro (By similarity). Associates with a PRC1-like complex.By similarity

Protein-protein interaction databases

BioGridi116609. 21 interactions.
IntActiQ96GD3. 10 interactions.
MINTiMINT-1422768.
STRINGi9606.ENSP00000318094.

Structurei

Secondary structure

1
660
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi30 – 367
Helixi44 – 463
Beta strandi47 – 493
Beta strandi63 – 686
Beta strandi71 – 8414
Beta strandi87 – 926
Beta strandi101 – 1044
Helixi115 – 1184
Helixi133 – 1353
Helixi136 – 1449
Helixi152 – 1543
Beta strandi172 – 1765
Beta strandi184 – 19310
Beta strandi196 – 2016
Turni205 – 2084
Beta strandi210 – 2134
Helixi224 – 2285

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2P0KX-ray1.75A27-238[»]
ProteinModelPortaliQ96GD3.
SMRiQ96GD3. Positions 27-235, 358-469, 590-655.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96GD3.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati28 – 12699MBT 1Add
BLAST
Repeati134 – 235102MBT 2Add
BLAST
Domaini593 – 65866SAMPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the SCM family.Curated
Contains 2 MBT repeats.PROSITE-ProRule annotation
Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiNOG315447.
GeneTreeiENSGT00760000119024.
HOGENOMiHOG000236280.
HOVERGENiHBG056406.
InParanoidiQ96GD3.
KOiK11461.
OMAiAPAHCFK.
OrthoDBiEOG73BVC2.
PhylomeDBiQ96GD3.
TreeFamiTF106488.

Family and domain databases

Gene3Di1.10.150.50. 1 hit.
InterProiIPR021987. DUF3588.
IPR004092. Mbt.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR021129. SAM_type1.
[Graphical view]
PfamiPF12140. DUF3588. 1 hit.
PF02820. MBT. 2 hits.
PF00536. SAM_1. 1 hit.
[Graphical view]
SMARTiSM00561. MBT. 2 hits.
SM00454. SAM. 1 hit.
[Graphical view]
SUPFAMiSSF47769. SSF47769. 1 hit.
PROSITEiPS51079. MBT. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96GD3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLVCYSVLAC EILWDLPCSI MGSPLGHFTW DKYLKETCSV PAPVHCFKQS
60 70 80 90 100
YTPPSNEFKI SMKLEAQDPR NTTSTCIATV VGLTGARLRL RLDGSDNKND
110 120 130 140 150
FWRLVDSAEI QPIGNCEKNG GMLQPPLGFR LNASSWPMFL LKTLNGAEMA
160 170 180 190 200
PIRIFHKEPP SPSHNFFKMG MKLEAVDRKN PHFICPATIG EVRGSEVLVT
210 220 230 240 250
FDGWRGAFDY WCRFDSRDIF PVGWCSLTGD NLQPPGTKVV IPKNPYPASD
260 270 280 290 300
VNTEKPSIHS STKTVLEHQP GQRGRKPGKK RGRTPKTLIS HPISAPSKTA
310 320 330 340 350
EPLKFPKKRG PKPGSKRKPR TLLNPPPASP TTSTPEPDTS TVPQDAATIP
360 370 380 390 400
SSAMQAPTVC IYLNKNGSTG PHLDKKKVQQ LPDHFGPARA SVVLQQAVQA
410 420 430 440 450
CIDCAYHQKT VFSFLKQGHG GEVISAVFDR EQHTLNLPAV NSITYVLRFL
460 470 480 490 500
EKLCHNLRSD NLFGNQPFTQ THLSLTAIEY SHSHDRYLPG ETFVLGNSLA
510 520 530 540 550
RSLEPHSDSM DSASNPTNLV STSQRHRPLL SSCGLPPSTA SAVRRLCSRG
560 570 580 590 600
VLKGSNERRD MESFWKLNRS PGSDRYLESR DASRLSGRDP SSWTVEDVMQ
610 620 630 640 650
FVREADPQLG PHADLFRKHE IDGKALLLLR SDMMMKYMGL KLGPALKLSY
660
HIDRLKQGKF

Note: No experimental confirmation available.Curated

Length:660
Mass (Da):73,354
Last modified:December 1, 2001 - v1
Checksum:i6544DD484DA8D037
GO
Isoform 2 (identifier: Q96GD3-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-24: MLVCYSVLACEILWDLPCSIMGSP → MQPNVIDWSDVRKHKYGHLSESASQYQEAADILD
     550-571: Missing.

Note: Gene prediction confirmed by EST data.

Show »
Length:648
Mass (Da):72,053
Checksum:i5DBA4803D9E8B3B5
GO
Isoform 3 (identifier: Q96GD3-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.

Show »
Length:599
Mass (Da):66,459
Checksum:iAC9C5AB96BDF79E1
GO
Isoform 41 Publication (identifier: Q96GD3-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
     550-571: Missing.

Show »
Length:591
Mass (Da):65,481
Checksum:iE5F43403878E53BA
GO
Isoform 51 Publication (identifier: Q96GD3-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-61: Missing.
     550-571: Missing.

Note: May be due to intron retention.1 Publication

Show »
Length:577
Mass (Da):63,870
Checksum:i1EC4A9E8452B66F0
GO
Isoform 6 (identifier: Q96GD3-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
     128-238: Missing.
     550-571: Missing.

Note: No experimental confirmation available.

Show »
Length:480
Mass (Da):52,908
Checksum:iCCD341EBF6748EF5
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti463 – 4631F → L1 PublicationCurated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 6161Missing in isoform 3 and isoform 5. 4 PublicationsVSP_051678Add
BLAST
Alternative sequencei1 – 4848MLVCY…VHCFK → M in isoform 4 and isoform 6. 2 PublicationsVSP_051677Add
BLAST
Alternative sequencei1 – 2424MLVCY…IMGSP → MQPNVIDWSDVRKHKYGHLS ESASQYQEAADILD in isoform 2. CuratedVSP_051676Add
BLAST
Alternative sequencei128 – 238111Missing in isoform 6. 1 PublicationVSP_043395Add
BLAST
Alternative sequencei550 – 57122Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_051679Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149045 mRNA. Translation: AAF01150.1.
AF149046 mRNA. Translation: AAF01151.1.
AK299383 mRNA. Translation: BAG61370.1.
CR457161 mRNA. Translation: CAG33442.1.
BX640721 mRNA. Translation: CAE45840.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22109.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22110.1.
AL110502, AL391730, AL606484 Genomic DNA. Translation: CAI22111.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22112.1.
AL110502, AL391730 Genomic DNA. Translation: CAI22113.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72791.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72793.1.
AL391730, AL110502, AL606484 Genomic DNA. Translation: CAH72794.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72795.1.
AL391730, AL110502 Genomic DNA. Translation: CAH72796.1.
AL606484, AL110502, AL391730 Genomic DNA. Translation: CAH72242.1.
BC009752 mRNA. Translation: AAH09752.1.
BC021252 mRNA. Translation: AAH21252.1.
CCDSiCCDS30688.1. [Q96GD3-1]
CCDS461.1. [Q96GD3-4]
CCDS53301.1. [Q96GD3-5]
CCDS53302.1. [Q96GD3-3]
CCDS53303.1. [Q96GD3-6]
CCDS53304.1. [Q96GD3-2]
RefSeqiNP_001026864.1. NM_001031694.2. [Q96GD3-1]
NP_001165689.1. NM_001172218.1. [Q96GD3-5]
NP_001165690.1. NM_001172219.1. [Q96GD3-2]
NP_001165691.1. NM_001172220.1. [Q96GD3-5]
NP_001165692.1. NM_001172221.1. [Q96GD3-3]
NP_001165693.1. NM_001172222.1. [Q96GD3-6]
NP_036368.1. NM_012236.3. [Q96GD3-4]
XP_005270696.1. XM_005270639.2. [Q96GD3-3]
XP_006710527.1. XM_006710464.1. [Q96GD3-3]
UniGeneiHs.571874.

Genome annotation databases

EnsembliENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
ENST00000397174; ENSP00000380359; ENSG00000010803. [Q96GD3-1]
ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-3]
ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
GeneIDi22955.
KEGGihsa:22955.
UCSCiuc001cgo.3. human. [Q96GD3-1]
uc001cgq.3. human. [Q96GD3-4]
uc001cgr.3. human. [Q96GD3-5]
uc001cgs.3. human. [Q96GD3-2]
uc010ojr.2. human. [Q96GD3-6]

Polymorphism databases

DMDMi60390956.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF149045 mRNA. Translation: AAF01150.1 .
AF149046 mRNA. Translation: AAF01151.1 .
AK299383 mRNA. Translation: BAG61370.1 .
CR457161 mRNA. Translation: CAG33442.1 .
BX640721 mRNA. Translation: CAE45840.1 .
AL110502 , AL391730 Genomic DNA. Translation: CAI22109.1 .
AL110502 , AL391730 Genomic DNA. Translation: CAI22110.1 .
AL110502 , AL391730 , AL606484 Genomic DNA. Translation: CAI22111.1 .
AL110502 , AL391730 Genomic DNA. Translation: CAI22112.1 .
AL110502 , AL391730 Genomic DNA. Translation: CAI22113.1 .
AL391730 , AL110502 Genomic DNA. Translation: CAH72791.1 .
AL391730 , AL110502 Genomic DNA. Translation: CAH72793.1 .
AL391730 , AL110502 , AL606484 Genomic DNA. Translation: CAH72794.1 .
AL391730 , AL110502 Genomic DNA. Translation: CAH72795.1 .
AL391730 , AL110502 Genomic DNA. Translation: CAH72796.1 .
AL606484 , AL110502 , AL391730 Genomic DNA. Translation: CAH72242.1 .
BC009752 mRNA. Translation: AAH09752.1 .
BC021252 mRNA. Translation: AAH21252.1 .
CCDSi CCDS30688.1. [Q96GD3-1 ]
CCDS461.1. [Q96GD3-4 ]
CCDS53301.1. [Q96GD3-5 ]
CCDS53302.1. [Q96GD3-3 ]
CCDS53303.1. [Q96GD3-6 ]
CCDS53304.1. [Q96GD3-2 ]
RefSeqi NP_001026864.1. NM_001031694.2. [Q96GD3-1 ]
NP_001165689.1. NM_001172218.1. [Q96GD3-5 ]
NP_001165690.1. NM_001172219.1. [Q96GD3-2 ]
NP_001165691.1. NM_001172220.1. [Q96GD3-5 ]
NP_001165692.1. NM_001172221.1. [Q96GD3-3 ]
NP_001165693.1. NM_001172222.1. [Q96GD3-6 ]
NP_036368.1. NM_012236.3. [Q96GD3-4 ]
XP_005270696.1. XM_005270639.2. [Q96GD3-3 ]
XP_006710527.1. XM_006710464.1. [Q96GD3-3 ]
UniGenei Hs.571874.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2P0K X-ray 1.75 A 27-238 [» ]
ProteinModelPortali Q96GD3.
SMRi Q96GD3. Positions 27-235, 358-469, 590-655.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 116609. 21 interactions.
IntActi Q96GD3. 10 interactions.
MINTi MINT-1422768.
STRINGi 9606.ENSP00000318094.

PTM databases

PhosphoSitei Q96GD3.

Polymorphism databases

DMDMi 60390956.

Proteomic databases

MaxQBi Q96GD3.
PaxDbi Q96GD3.
PRIDEi Q96GD3.

Protocols and materials databases

DNASUi 22955.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000326197 ; ENSP00000318094 ; ENSG00000010803 . [Q96GD3-1 ]
ENST00000337495 ; ENSP00000337352 ; ENSG00000010803 . [Q96GD3-2 ]
ENST00000361191 ; ENSP00000354656 ; ENSG00000010803 . [Q96GD3-5 ]
ENST00000361705 ; ENSP00000354996 ; ENSG00000010803 . [Q96GD3-4 ]
ENST00000372595 ; ENSP00000361676 ; ENSG00000010803 . [Q96GD3-3 ]
ENST00000372596 ; ENSP00000361677 ; ENSG00000010803 . [Q96GD3-5 ]
ENST00000372597 ; ENSP00000361678 ; ENSG00000010803 . [Q96GD3-4 ]
ENST00000397171 ; ENSP00000380356 ; ENSG00000010803 . [Q96GD3-5 ]
ENST00000397174 ; ENSP00000380359 ; ENSG00000010803 . [Q96GD3-1 ]
ENST00000402904 ; ENSP00000386079 ; ENSG00000010803 . [Q96GD3-3 ]
ENST00000456518 ; ENSP00000403974 ; ENSG00000010803 . [Q96GD3-6 ]
GeneIDi 22955.
KEGGi hsa:22955.
UCSCi uc001cgo.3. human. [Q96GD3-1 ]
uc001cgq.3. human. [Q96GD3-4 ]
uc001cgr.3. human. [Q96GD3-5 ]
uc001cgs.3. human. [Q96GD3-2 ]
uc010ojr.2. human. [Q96GD3-6 ]

Organism-specific databases

CTDi 22955.
GeneCardsi GC01M041527.
HGNCi HGNC:19003. SCMH1.
HPAi HPA048898.
HPA053292.
neXtProti NX_Q96GD3.
PharmGKBi PA134870272.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG315447.
GeneTreei ENSGT00760000119024.
HOGENOMi HOG000236280.
HOVERGENi HBG056406.
InParanoidi Q96GD3.
KOi K11461.
OMAi APAHCFK.
OrthoDBi EOG73BVC2.
PhylomeDBi Q96GD3.
TreeFami TF106488.

Enzyme and pathway databases

Reactomei REACT_169436. Oxidative Stress Induced Senescence.

Miscellaneous databases

EvolutionaryTracei Q96GD3.
GeneWikii SCMH1.
GenomeRNAii 22955.
NextBioi 43747.
PROi Q96GD3.

Gene expression databases

Bgeei Q96GD3.
CleanExi HS_SCMH1.
Genevestigatori Q96GD3.

Family and domain databases

Gene3Di 1.10.150.50. 1 hit.
InterProi IPR021987. DUF3588.
IPR004092. Mbt.
IPR001660. SAM.
IPR013761. SAM/pointed.
IPR021129. SAM_type1.
[Graphical view ]
Pfami PF12140. DUF3588. 1 hit.
PF02820. MBT. 2 hits.
PF00536. SAM_1. 1 hit.
[Graphical view ]
SMARTi SM00561. MBT. 2 hits.
SM00454. SAM. 1 hit.
[Graphical view ]
SUPFAMi SSF47769. SSF47769. 1 hit.
PROSITEi PS51079. MBT. 2 hits.
PS50105. SAM_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "The human homolog of Sex comb on midleg (SCMH1) maps to chromosome 1p34."
    Berger J., Kurahashi H., Takihara Y., Shimada K., Brock H.W., Randazzo F.
    Gene 237:185-191(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), TISSUE SPECIFICITY.
    Tissue: HeartImported and Skeletal muscle1 Publication.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
    Tissue: Tongue.
  3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
    Tissue: Fetal brain.
  5. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 2).
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: EyeImported and MuscleImported.
  7. "The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans."
    Levine S.S., Weiss A., Erdjument-Bromage H., Shao Z., Tempst P., Kingston R.E.
    Mol. Cell. Biol. 22:6070-6078(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, ASSOCIATION WITH A PRC1-LIKE COMPLEX.

Entry informationi

Entry nameiSCMH1_HUMAN
AccessioniPrimary (citable) accession number: Q96GD3
Secondary accession number(s): B4DRQ8
, Q5VT76, Q6IAJ4, Q8WU48, Q9UKM5, Q9UKM6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3