Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96GD3

- SCMH1_HUMAN

UniProt

Q96GD3 - SCMH1_HUMAN

Protein

Polycomb protein SCMH1

Gene

SCMH1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 115 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Associates with Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes.By similarity

    GO - Molecular functioni

    1. DNA binding Source: ProtInc
    2. sequence-specific DNA binding transcription factor activity Source: ProtInc

    GO - Biological processi

    1. anatomical structure morphogenesis Source: ProtInc
    2. anterior/posterior pattern specification Source: Ensembl
    3. chromatin remodeling Source: Ensembl
    4. gene silencing Source: UniProtKB
    5. negative regulation of transcription, DNA-templated Source: UniProtKB
    6. spermatogenesis Source: Ensembl
    7. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Developmental protein, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Enzyme and pathway databases

    ReactomeiREACT_169436. Oxidative Stress Induced Senescence.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Polycomb protein SCMH1
    Alternative name(s):
    Sex comb on midleg homolog 1
    Gene namesi
    Name:SCMH1Imported
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:19003. SCMH1.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. chromocenter Source: Ensembl
    2. nucleoplasm Source: Reactome
    3. nucleus Source: UniProtKB

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134870272.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 660660Polycomb protein SCMH1PRO_0000114334Add
    BLAST

    Proteomic databases

    MaxQBiQ96GD3.
    PaxDbiQ96GD3.
    PRIDEiQ96GD3.

    PTM databases

    PhosphoSiteiQ96GD3.

    Expressioni

    Tissue specificityi

    Strongly expressed in heart, muscle and pancreas. Weakly expressed in brain, placenta, lung, liver and kidney.1 Publication

    Gene expression databases

    ArrayExpressiQ96GD3.
    BgeeiQ96GD3.
    CleanExiHS_SCMH1.
    GenevestigatoriQ96GD3.

    Organism-specific databases

    HPAiHPA048898.
    HPA053292.

    Interactioni

    Subunit structurei

    Interacts with the SAM domain of PHC1 via its SAM domain in vitro By similarity. Associates with a PRC1-like complex.By similarity

    Protein-protein interaction databases

    BioGridi116609. 21 interactions.
    IntActiQ96GD3. 10 interactions.
    MINTiMINT-1422768.
    STRINGi9606.ENSP00000318094.

    Structurei

    Secondary structure

    1
    660
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi30 – 367
    Helixi44 – 463
    Beta strandi47 – 493
    Beta strandi63 – 686
    Beta strandi71 – 8414
    Beta strandi87 – 926
    Beta strandi101 – 1044
    Helixi115 – 1184
    Helixi133 – 1353
    Helixi136 – 1449
    Helixi152 – 1543
    Beta strandi172 – 1765
    Beta strandi184 – 19310
    Beta strandi196 – 2016
    Turni205 – 2084
    Beta strandi210 – 2134
    Helixi224 – 2285

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2P0KX-ray1.75A27-238[»]
    ProteinModelPortaliQ96GD3.
    SMRiQ96GD3. Positions 27-337, 590-655.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96GD3.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati28 – 12699MBT 1Add
    BLAST
    Repeati134 – 235102MBT 2Add
    BLAST
    Domaini593 – 65866SAMPROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Belongs to the SCM family.Curated
    Contains 2 MBT repeats.PROSITE-ProRule annotation
    Contains 1 SAM (sterile alpha motif) domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat

    Phylogenomic databases

    eggNOGiNOG315447.
    HOGENOMiHOG000236280.
    HOVERGENiHBG056406.
    InParanoidiQ96GD3.
    KOiK11461.
    OMAiAPAHCFK.
    OrthoDBiEOG73BVC2.
    PhylomeDBiQ96GD3.
    TreeFamiTF106488.

    Family and domain databases

    Gene3Di1.10.150.50. 1 hit.
    InterProiIPR021987. DUF3588.
    IPR004092. Mbt.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR021129. SAM_type1.
    [Graphical view]
    PfamiPF12140. DUF3588. 1 hit.
    PF02820. MBT. 2 hits.
    PF00536. SAM_1. 1 hit.
    [Graphical view]
    SMARTiSM00561. MBT. 2 hits.
    SM00454. SAM. 1 hit.
    [Graphical view]
    SUPFAMiSSF47769. SSF47769. 1 hit.
    PROSITEiPS51079. MBT. 2 hits.
    PS50105. SAM_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96GD3-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MLVCYSVLAC EILWDLPCSI MGSPLGHFTW DKYLKETCSV PAPVHCFKQS    50
    YTPPSNEFKI SMKLEAQDPR NTTSTCIATV VGLTGARLRL RLDGSDNKND 100
    FWRLVDSAEI QPIGNCEKNG GMLQPPLGFR LNASSWPMFL LKTLNGAEMA 150
    PIRIFHKEPP SPSHNFFKMG MKLEAVDRKN PHFICPATIG EVRGSEVLVT 200
    FDGWRGAFDY WCRFDSRDIF PVGWCSLTGD NLQPPGTKVV IPKNPYPASD 250
    VNTEKPSIHS STKTVLEHQP GQRGRKPGKK RGRTPKTLIS HPISAPSKTA 300
    EPLKFPKKRG PKPGSKRKPR TLLNPPPASP TTSTPEPDTS TVPQDAATIP 350
    SSAMQAPTVC IYLNKNGSTG PHLDKKKVQQ LPDHFGPARA SVVLQQAVQA 400
    CIDCAYHQKT VFSFLKQGHG GEVISAVFDR EQHTLNLPAV NSITYVLRFL 450
    EKLCHNLRSD NLFGNQPFTQ THLSLTAIEY SHSHDRYLPG ETFVLGNSLA 500
    RSLEPHSDSM DSASNPTNLV STSQRHRPLL SSCGLPPSTA SAVRRLCSRG 550
    VLKGSNERRD MESFWKLNRS PGSDRYLESR DASRLSGRDP SSWTVEDVMQ 600
    FVREADPQLG PHADLFRKHE IDGKALLLLR SDMMMKYMGL KLGPALKLSY 650
    HIDRLKQGKF 660

    Note: No experimental confirmation available.Curated

    Length:660
    Mass (Da):73,354
    Last modified:December 1, 2001 - v1
    Checksum:i6544DD484DA8D037
    GO
    Isoform 2 (identifier: Q96GD3-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-24: MLVCYSVLACEILWDLPCSIMGSP → MQPNVIDWSDVRKHKYGHLSESASQYQEAADILD
         550-571: Missing.

    Note: Gene prediction confirmed by EST data.

    Show »
    Length:648
    Mass (Da):72,053
    Checksum:i5DBA4803D9E8B3B5
    GO
    Isoform 3 (identifier: Q96GD3-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: Missing.

    Show »
    Length:599
    Mass (Da):66,459
    Checksum:iAC9C5AB96BDF79E1
    GO
    Isoform 41 Publication (identifier: Q96GD3-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
         550-571: Missing.

    Show »
    Length:591
    Mass (Da):65,481
    Checksum:iE5F43403878E53BA
    GO
    Isoform 51 Publication (identifier: Q96GD3-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-61: Missing.
         550-571: Missing.

    Note: May be due to intron retention.1 Publication

    Show »
    Length:577
    Mass (Da):63,870
    Checksum:i1EC4A9E8452B66F0
    GO
    Isoform 6 (identifier: Q96GD3-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-48: MLVCYSVLACEILWDLPCSIMGSPLGHFTWDKYLKETCSVPAPVHCFK → M
         128-238: Missing.
         550-571: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:480
    Mass (Da):52,908
    Checksum:iCCD341EBF6748EF5
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti463 – 4631F → L1 PublicationCurated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 6161Missing in isoform 3 and isoform 5. 4 PublicationsVSP_051678Add
    BLAST
    Alternative sequencei1 – 4848MLVCY…VHCFK → M in isoform 4 and isoform 6. 2 PublicationsVSP_051677Add
    BLAST
    Alternative sequencei1 – 2424MLVCY…IMGSP → MQPNVIDWSDVRKHKYGHLS ESASQYQEAADILD in isoform 2. CuratedVSP_051676Add
    BLAST
    Alternative sequencei128 – 238111Missing in isoform 6. 1 PublicationVSP_043395Add
    BLAST
    Alternative sequencei550 – 57122Missing in isoform 2, isoform 4, isoform 5 and isoform 6. 3 PublicationsVSP_051679Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149045 mRNA. Translation: AAF01150.1.
    AF149046 mRNA. Translation: AAF01151.1.
    AK299383 mRNA. Translation: BAG61370.1.
    CR457161 mRNA. Translation: CAG33442.1.
    BX640721 mRNA. Translation: CAE45840.1.
    AL110502, AL391730 Genomic DNA. Translation: CAI22109.1.
    AL110502, AL391730 Genomic DNA. Translation: CAI22110.1.
    AL110502, AL391730, AL606484 Genomic DNA. Translation: CAI22111.1.
    AL110502, AL391730 Genomic DNA. Translation: CAI22112.1.
    AL110502, AL391730 Genomic DNA. Translation: CAI22113.1.
    AL391730, AL110502 Genomic DNA. Translation: CAH72791.1.
    AL391730, AL110502 Genomic DNA. Translation: CAH72793.1.
    AL391730, AL110502, AL606484 Genomic DNA. Translation: CAH72794.1.
    AL391730, AL110502 Genomic DNA. Translation: CAH72795.1.
    AL391730, AL110502 Genomic DNA. Translation: CAH72796.1.
    AL606484, AL110502, AL391730 Genomic DNA. Translation: CAH72242.1.
    BC009752 mRNA. Translation: AAH09752.1.
    BC021252 mRNA. Translation: AAH21252.1.
    CCDSiCCDS30688.1. [Q96GD3-1]
    CCDS461.1. [Q96GD3-4]
    CCDS53301.1. [Q96GD3-5]
    CCDS53302.1. [Q96GD3-3]
    CCDS53303.1. [Q96GD3-6]
    CCDS53304.1. [Q96GD3-2]
    RefSeqiNP_001026864.1. NM_001031694.2. [Q96GD3-1]
    NP_001165689.1. NM_001172218.1. [Q96GD3-5]
    NP_001165690.1. NM_001172219.1. [Q96GD3-2]
    NP_001165691.1. NM_001172220.1. [Q96GD3-5]
    NP_001165692.1. NM_001172221.1. [Q96GD3-3]
    NP_001165693.1. NM_001172222.1. [Q96GD3-6]
    NP_036368.1. NM_012236.3. [Q96GD3-4]
    XP_005270696.1. XM_005270639.2. [Q96GD3-3]
    XP_006710527.1. XM_006710464.1. [Q96GD3-3]
    UniGeneiHs.571874.

    Genome annotation databases

    EnsembliENST00000326197; ENSP00000318094; ENSG00000010803. [Q96GD3-1]
    ENST00000337495; ENSP00000337352; ENSG00000010803. [Q96GD3-2]
    ENST00000361191; ENSP00000354656; ENSG00000010803. [Q96GD3-5]
    ENST00000361705; ENSP00000354996; ENSG00000010803. [Q96GD3-4]
    ENST00000372595; ENSP00000361676; ENSG00000010803. [Q96GD3-3]
    ENST00000372596; ENSP00000361677; ENSG00000010803. [Q96GD3-5]
    ENST00000372597; ENSP00000361678; ENSG00000010803. [Q96GD3-4]
    ENST00000397171; ENSP00000380356; ENSG00000010803. [Q96GD3-5]
    ENST00000402904; ENSP00000386079; ENSG00000010803. [Q96GD3-1]
    ENST00000456518; ENSP00000403974; ENSG00000010803. [Q96GD3-6]
    GeneIDi22955.
    KEGGihsa:22955.
    UCSCiuc001cgo.3. human. [Q96GD3-1]
    uc001cgq.3. human. [Q96GD3-4]
    uc001cgr.3. human. [Q96GD3-5]
    uc001cgs.3. human. [Q96GD3-2]
    uc010ojr.2. human. [Q96GD3-6]

    Polymorphism databases

    DMDMi60390956.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF149045 mRNA. Translation: AAF01150.1 .
    AF149046 mRNA. Translation: AAF01151.1 .
    AK299383 mRNA. Translation: BAG61370.1 .
    CR457161 mRNA. Translation: CAG33442.1 .
    BX640721 mRNA. Translation: CAE45840.1 .
    AL110502 , AL391730 Genomic DNA. Translation: CAI22109.1 .
    AL110502 , AL391730 Genomic DNA. Translation: CAI22110.1 .
    AL110502 , AL391730 , AL606484 Genomic DNA. Translation: CAI22111.1 .
    AL110502 , AL391730 Genomic DNA. Translation: CAI22112.1 .
    AL110502 , AL391730 Genomic DNA. Translation: CAI22113.1 .
    AL391730 , AL110502 Genomic DNA. Translation: CAH72791.1 .
    AL391730 , AL110502 Genomic DNA. Translation: CAH72793.1 .
    AL391730 , AL110502 , AL606484 Genomic DNA. Translation: CAH72794.1 .
    AL391730 , AL110502 Genomic DNA. Translation: CAH72795.1 .
    AL391730 , AL110502 Genomic DNA. Translation: CAH72796.1 .
    AL606484 , AL110502 , AL391730 Genomic DNA. Translation: CAH72242.1 .
    BC009752 mRNA. Translation: AAH09752.1 .
    BC021252 mRNA. Translation: AAH21252.1 .
    CCDSi CCDS30688.1. [Q96GD3-1 ]
    CCDS461.1. [Q96GD3-4 ]
    CCDS53301.1. [Q96GD3-5 ]
    CCDS53302.1. [Q96GD3-3 ]
    CCDS53303.1. [Q96GD3-6 ]
    CCDS53304.1. [Q96GD3-2 ]
    RefSeqi NP_001026864.1. NM_001031694.2. [Q96GD3-1 ]
    NP_001165689.1. NM_001172218.1. [Q96GD3-5 ]
    NP_001165690.1. NM_001172219.1. [Q96GD3-2 ]
    NP_001165691.1. NM_001172220.1. [Q96GD3-5 ]
    NP_001165692.1. NM_001172221.1. [Q96GD3-3 ]
    NP_001165693.1. NM_001172222.1. [Q96GD3-6 ]
    NP_036368.1. NM_012236.3. [Q96GD3-4 ]
    XP_005270696.1. XM_005270639.2. [Q96GD3-3 ]
    XP_006710527.1. XM_006710464.1. [Q96GD3-3 ]
    UniGenei Hs.571874.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2P0K X-ray 1.75 A 27-238 [» ]
    ProteinModelPortali Q96GD3.
    SMRi Q96GD3. Positions 27-337, 590-655.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 116609. 21 interactions.
    IntActi Q96GD3. 10 interactions.
    MINTi MINT-1422768.
    STRINGi 9606.ENSP00000318094.

    PTM databases

    PhosphoSitei Q96GD3.

    Polymorphism databases

    DMDMi 60390956.

    Proteomic databases

    MaxQBi Q96GD3.
    PaxDbi Q96GD3.
    PRIDEi Q96GD3.

    Protocols and materials databases

    DNASUi 22955.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000326197 ; ENSP00000318094 ; ENSG00000010803 . [Q96GD3-1 ]
    ENST00000337495 ; ENSP00000337352 ; ENSG00000010803 . [Q96GD3-2 ]
    ENST00000361191 ; ENSP00000354656 ; ENSG00000010803 . [Q96GD3-5 ]
    ENST00000361705 ; ENSP00000354996 ; ENSG00000010803 . [Q96GD3-4 ]
    ENST00000372595 ; ENSP00000361676 ; ENSG00000010803 . [Q96GD3-3 ]
    ENST00000372596 ; ENSP00000361677 ; ENSG00000010803 . [Q96GD3-5 ]
    ENST00000372597 ; ENSP00000361678 ; ENSG00000010803 . [Q96GD3-4 ]
    ENST00000397171 ; ENSP00000380356 ; ENSG00000010803 . [Q96GD3-5 ]
    ENST00000402904 ; ENSP00000386079 ; ENSG00000010803 . [Q96GD3-1 ]
    ENST00000456518 ; ENSP00000403974 ; ENSG00000010803 . [Q96GD3-6 ]
    GeneIDi 22955.
    KEGGi hsa:22955.
    UCSCi uc001cgo.3. human. [Q96GD3-1 ]
    uc001cgq.3. human. [Q96GD3-4 ]
    uc001cgr.3. human. [Q96GD3-5 ]
    uc001cgs.3. human. [Q96GD3-2 ]
    uc010ojr.2. human. [Q96GD3-6 ]

    Organism-specific databases

    CTDi 22955.
    GeneCardsi GC01M041527.
    HGNCi HGNC:19003. SCMH1.
    HPAi HPA048898.
    HPA053292.
    neXtProti NX_Q96GD3.
    PharmGKBi PA134870272.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG315447.
    HOGENOMi HOG000236280.
    HOVERGENi HBG056406.
    InParanoidi Q96GD3.
    KOi K11461.
    OMAi APAHCFK.
    OrthoDBi EOG73BVC2.
    PhylomeDBi Q96GD3.
    TreeFami TF106488.

    Enzyme and pathway databases

    Reactomei REACT_169436. Oxidative Stress Induced Senescence.

    Miscellaneous databases

    EvolutionaryTracei Q96GD3.
    GeneWikii SCMH1.
    GenomeRNAii 22955.
    NextBioi 43747.
    PROi Q96GD3.

    Gene expression databases

    ArrayExpressi Q96GD3.
    Bgeei Q96GD3.
    CleanExi HS_SCMH1.
    Genevestigatori Q96GD3.

    Family and domain databases

    Gene3Di 1.10.150.50. 1 hit.
    InterProi IPR021987. DUF3588.
    IPR004092. Mbt.
    IPR001660. SAM.
    IPR013761. SAM/pointed.
    IPR021129. SAM_type1.
    [Graphical view ]
    Pfami PF12140. DUF3588. 1 hit.
    PF02820. MBT. 2 hits.
    PF00536. SAM_1. 1 hit.
    [Graphical view ]
    SMARTi SM00561. MBT. 2 hits.
    SM00454. SAM. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47769. SSF47769. 1 hit.
    PROSITEi PS51079. MBT. 2 hits.
    PS50105. SAM_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "The human homolog of Sex comb on midleg (SCMH1) maps to chromosome 1p34."
      Berger J., Kurahashi H., Takihara Y., Shimada K., Brock H.W., Randazzo F.
      Gene 237:185-191(1999) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 4 AND 5), TISSUE SPECIFICITY.
      Tissue: HeartImported and Skeletal muscle1 Publication.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
      Tissue: Tongue.
    3. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
      Tissue: Fetal brain.
    5. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA] (ISOFORM 2).
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: EyeImported and MuscleImported.
    7. "The core of the polycomb repressive complex is compositionally and functionally conserved in flies and humans."
      Levine S.S., Weiss A., Erdjument-Bromage H., Shao Z., Tempst P., Kingston R.E.
      Mol. Cell. Biol. 22:6070-6078(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, ASSOCIATION WITH A PRC1-LIKE COMPLEX.

    Entry informationi

    Entry nameiSCMH1_HUMAN
    AccessioniPrimary (citable) accession number: Q96GD3
    Secondary accession number(s): B4DRQ8
    , Q5VT76, Q6IAJ4, Q8WU48, Q9UKM5, Q9UKM6
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 1, 2005
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 115 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3