Q96G97 (BSCL2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 96.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Seipin Alternative name(s): Bernardinelli-Seip congenital lipodystrophy type 2 protein | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 398 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Is a regulator of lipid catabolism essential for adipocyte differentiation. May also be involved in the central regulation of energy homeostasis By similarity. Necessary for correct lipid storage and lipid droplets maintenance; may play a tissue-autonomous role in controlling lipid storage in adipocytes and in preventing ectopic lipid droplet formation in non-adipose tissues. Ref.11 Ref.12 |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein Ref.7 Ref.8 Ref.9. |
| Tissue specificity | Expressed in motor neurons in the spinal cord and cortical neurons in the frontal lobe (at protein level). Highly expressed in brain, testis and adipose tissue. Ref.6 Ref.9 Ref.10 |
| Involvement in disease | Congenital generalized lipodystrophy 2 (CGL2) [MIM:269700]: An autosomal recessive disorder characterized by a near complete absence of adipose tissue, extreme insulin resistance, hypertriglyceridemia, hepatic steatosis and early onset of diabetes. Spastic paraplegia 17 (SPG17) [MIM:270685]: A form of spastic paraplegia, a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Rate of progression and the severity of symptoms are quite variable. Initial symptoms may include difficulty with balance, weakness and stiffness in the legs, muscle spasms, and dragging the toes when walking. In some forms of the disorder, bladder symptoms (such as incontinence) may appear, or the weakness and stiffness may spread to other parts of the body. SPG17 is characterized by prominent amyotrophy of the hand muscles, the presence of mild to severe pyramidal tract signs and spastic paraplegia. SPG17 is a motor neuron disease overlapping with distal spinal muscular atrophy type 5. Distal hereditary motor neuronopathy 5A (HMN5A) [MIM:600794]: A disorder characterized by distal muscular atrophy mainly affecting the upper extremities, in contrast to other distal motor neuronopathies. These constitute a heterogeneous group of neuromuscular diseases caused by selective degeneration of motor neurons in the anterior horn of the spinal cord, without sensory deficit in the posterior horn. The overall clinical picture consists of a classical distal muscular atrophy syndrome in the legs without clinical sensory loss. The disease starts with weakness and wasting of distal muscles of the anterior tibial and peroneal compartments of the legs. Later on, weakness and atrophy may expand to the proximal muscles of the lower limbs and/or to the distal upper limbs. |
| Sequence similarities | Belongs to the seipin family. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96G97-2) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96G97-3) The sequence of this isoform differs from the canonical sequence as follows: 225-287: YLLYNFPMTC...DNSRKEVQRR → LTSEKETIPG...PRRRNQISSP 288-398: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96G97-4) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSTEKVDQKEEAGEKEVCGDQIKGPDKEEEPPAAASHGQGWRPGGRAARNARPEPGARHPALPAM | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 398 | 398 | Seipin | PRO_0000191679 | |||||
Regions | |||||||||
| Topological domain | 1 – 26 | 26 | Cytoplasmic Potential | ||||||
| Transmembrane | 27 – 47 | 21 | Helical; Potential | ||||||
| Topological domain | 48 – 242 | 195 | Lumenal Potential | ||||||
| Transmembrane | 243 – 263 | 21 | Helical; Potential | ||||||
| Topological domain | 264 – 398 | 135 | Cytoplasmic Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 88 | 1 | N-linked (GlcNAc...) Ref.7 | ||||||
| Glycosylation | 242 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSTEKVDQKEEAGEKEVCGD QIKGPDKEEEPPAAASHGQG WRPGGRAARNARPEPGARHP ALPAM in isoform 3. | VSP_044545 | |||||
| Alternative sequence | 225 – 287 | 63 | YLLYN…EVQRR → LTSEKETIPGRKSNEGSLLI SQGLKARRSQLRNQMLQRMV RALKIPQGQRVSCPRRRNQI SSP in isoform 2. | VSP_051726 | |||||
| Alternative sequence | 288 – 398 | 111 | Missing in isoform 2. | VSP_051727 | |||||
| Natural variant | 88 | 1 | N → S in SPG17 and HMN5A; does not affect protein subcellular location. Ref.7 Ref.10 | VAR_022375 | |||||
| Natural variant | 90 | 1 | S → L in SPG17 and HMN5A; does not affect the function in lipid storage. Ref.7 Ref.12 | VAR_022376 | |||||
| Natural variant | 212 | 1 | A → P in CGL2; increases localization to nuclear envelope. Ref.6 Ref.9 | VAR_022377 | |||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Retinoblastoma and Teratocarcinoma. |
| [2] | Yu W., Sarginson J., Gibbs R.A. Submitted (MAR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Kidney, Lung, Pancreas and Pituitary. |
| [6] | "Identification of the gene altered in Berardinelli-Seip congenital lipodystrophy on chromosome 11q13." Magre J., Delepine M., Khallouf E., Gedde-Dahl T. Jr., Van Maldergem L., Sobel E., Papp J., Meier M., Megarbane A., Bachy A., Verloes A., d'Abronzo F.H., Seemanova E., Assan R., Baudic N., Bourut C., Czernichow P., Huet F. Capeau J.Nat. Genet. 28:365-370(2001) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, VARIANT CGL2 PRO-212. |
| [7] | "Heterozygous missense mutations in BSCL2 are associated with distal hereditary motor neuropathy and Silver syndrome." Windpassinger C., Auer-Grumbach M., Irobi J., Patel H., Petek E., Hoerl G., Malli R., Reed J.A., Dierick I., Verpoorten N., Warner T.T., Proukakis C., Van den Bergh P., Verellen C., Van Maldergem L., Merlini L., De Jonghe P., Timmerman V., Crosby A.H., Wagner K. Nat. Genet. 36:271-276(2004) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, GLYCOSYLATION AT ASN-88, VARIANTS SPG17 AND HMN5A SER-88 AND LEU-90. |
| [8] | "Membrane topology of the human seipin protein." Lundin C., Nordstrom R., Wagner K., Windpassinger C., Andersson H., von Heijne G., Nilsson I. FEBS Lett. 580:2281-2284(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TOPOLOGY. |
| [9] | "The human lipodystrophy gene BSCL2/seipin may be essential for normal adipocyte differentiation." Payne V.A., Grimsey N., Tuthill A., Virtue S., Gray S.L., Dalla Nora E., Semple R.K., O'Rahilly S., Rochford J.J. Diabetes 57:2055-2060(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT PRO-212. |
| [10] | "Characterization of seipin/BSCL2, a protein associated with spastic paraplegia 17." Ito D., Fujisawa T., Iida H., Suzuki N. Neurobiol. Dis. 31:266-277(2008) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, CHARACTERIZATION OF VARIANT SPG17 SER-88. |
| [11] | "Seipin deficiency alters fatty acid Delta9 desaturation and lipid droplet formation in Berardinelli-Seip congenital lipodystrophy." Boutet E., El Mourabit H., Prot M., Nemani M., Khallouf E., Colard O., Maurice M., Durand-Schneider A.M., Chretien Y., Gres S., Wolf C., Saulnier-Blache J.S., Capeau J., Magre J. Biochimie 91:796-803(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "Tissue-autonomous function of Drosophila seipin in preventing ectopic lipid droplet formation." Tian Y., Bi J., Shui G., Liu Z., Xiang Y., Liu Y., Wenk M.R., Yang H., Huang X. PLoS Genet. 7:E1001364-E1001364(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, VARIANT LEU-90. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK027524 mRNA. Translation: BAB55175.1. AK075317 mRNA. Translation: BAC11543.1. AF052149 mRNA. No translation available. CH471076 Genomic DNA. Translation: EAW74070.1. CH471076 Genomic DNA. Translation: EAW74074.1. AP001458 Genomic DNA. No translation available. BC004911 mRNA. Translation: AAH04911.1. BC012140 mRNA. Translation: AAH12140.1. BC041640 mRNA. Translation: AAH41640.1. BC093048 mRNA. Translation: AAH93048.1. |
| IPI | IPI00045906. IPI00783278. |
| RefSeq | NP_001116427.1. NM_001122955.3. NP_001124174.2. NM_001130702.2. NP_116056.3. NM_032667.6. |
| UniGene | Hs.533709. |
3D structure databases | |
| ProteinModelPortal | Q96G97. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96G97. 5 interactions. |
| MINT | MINT-1452482. |
| STRING | 9606.ENSP00000354032. |
PTM databases | |
| PhosphoSite | Q96G97. |
Polymorphism databases | |
| DMDM | 269849705. |
Proteomic databases | |
| PaxDb | Q96G97. |
| PRIDE | Q96G97. |
Protocols and materials databases | |
| DNASU | 26580. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000278893; ENSP00000278893; ENSG00000168000. ENST00000360796; ENSP00000354032; ENSG00000168000. ENST00000403550; ENSP00000385561; ENSG00000168000. ENST00000407022; ENSP00000384080; ENSG00000168000. ENST00000421906; ENSP00000413209; ENSG00000168000. ENST00000433053; ENSP00000414002; ENSG00000168000. |
| GeneID | 26580. |
| KEGG | hsa:26580. |
| UCSC | uc001nup.3. human. uc009yoc.2. human. |
Organism-specific databases | |
| CTD | 26580. |
| GeneCards | GC11M062457. |
| HGNC | HGNC:15832. BSCL2. |
| HPA | HPA042394. |
| MIM | 269700. phenotype. 270685. phenotype. 600794. phenotype. 606158. gene. |
| neXtProt | NX_Q96G97. |
| Orphanet | 100998. Autosomal dominant spastic paraplegia type 17. 528. Berardinelli-Seip congenital lipodystrophy. 139536. Distal hereditary motor neuropathy type 5. |
| PharmGKB | PA25432. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG316839. |
| HOGENOM | HOG000220875. |
| HOVERGEN | HBG050736. |
| OrthoDB | EOG40CHHQ. |
Gene expression databases | |
| ArrayExpress | Q96G97. |
| Bgee | Q96G97. |
| CleanEx | HS_BSCL2. |
| Genevestigator | Q96G97. |
| GermOnline | ENSG00000168000. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR009617. Adipose-reg_protein_Seipin. [Graphical view] |
| Pfam | PF06775. Seipin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | BSCL2. human. |
| GenomeRNAi | 26580. |
| NextBio | 48934. |
| SOURCE | Search... |
Entry information
| Entry name | BSCL2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96G97 Secondary accession number(s): G3XAE4 Q9BSQ0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
