Q96G25 (MED8_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Mediator of RNA polymerase II transcription subunit 8 Alternative name(s): Activator-recruited cofactor 32 kDa component Short name=ARC32 Mediator complex subunit 8 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 268 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. May play a role as a target recruitment subunit in E3 ubiquitin-protein ligase complexes and thus in ubiquitination and subsequent proteasomal degradation of target proteins. |
| Pathway | |
| Subunit structure | Component of the Mediator complex, which is composed of MED1, MED4, MED6, MED7, MED8, MED9, MED10, MED11, MED12, MED13, MED13L, MED14, MED15, MED16, MED17, MED18, MED19, MED20, MED21, MED22, MED23, MED24, MED25, MED26, MED27, MED29, MED30, MED31, CCNC, CDK8 and CDC2L6/CDK11. The MED12, MED13, CCNC and CDK8 subunits form a distinct module termed the CDK8 module. Mediator containing the CDK8 module is less active than Mediator lacking this module in supporting transcriptional activation. Individual preparations of the Mediator complex lacking one or more distinct subunits have been variously termed ARC, CRSP, DRIP, PC2, SMCC and TRAP. May be part of a multisubunit E3 ubiquitin-protein ligase complex with the elongin BC complex (TCEB1 and TCEB2), CUL2 and RBX1. Ref.1 Ref.4 Ref.6 Ref.7 |
| Subcellular location | Nucleus Probable. |
| Domain | The elongin BC complex binding domain is also known as BC-box with the consensus [APST]-L-x(3)-C-x(3)-[AILV]. |
| Sequence similarities | Belongs to the Mediator complex subunit 8 family. |
| Sequence caution | The sequence BG722466 differs from that shown. Reason: Frameshift at position 258. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transcription Transcription regulation Ubl conjugation pathway |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| Molecular function | Activator |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | protein ubiquitination Inferred from electronic annotation. Source: UniProtKB-UniPathway transcription initiation from RNA polymerase II promoterTraceable author statement. Source: Reactome |
| Cellular_component | mediator complex Inferred from direct assay PubMed 14638676. Source: MGI |
| Molecular_function | RNA polymerase II transcription cofactor activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| TCEB1 | Q15369 | 3 | EBI-394405,EBI-301231 | |
| TCEB2 | Q15370 | 5 | EBI-394405,EBI-301238 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96G25-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96G25-2) The sequence of this isoform differs from the canonical sequence as follows: 268-268: R → RPSCLGFILAIPLRRKVKKLLGQEGKKNAHLQLW | ||||||
| Isoform 3 (identifier: Q96G25-3) The sequence of this isoform differs from the canonical sequence as follows: 1-89: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 268 | 268 | Mediator of RNA polymerase II transcription subunit 8 | PRO_0000096394 | |||||
Regions | |||||||||
| Region | 142 – 151 | 10 | Interaction with the Elongin BC complex | ||||||
| Coiled coil | 1 – 28 | 28 | Potential | ||||||
| Coiled coil | 133 – 163 | 31 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 82 | 1 | Phosphoserine Ref.8 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 89 | 89 | Missing in isoform 3. | VSP_035507 | |||||
| Alternative sequence | 268 | 1 | R → RPSCLGFILAIPLRRKVKKL LGQEGKKNAHLQLW in isoform 2. | VSP_007524 | |||||
Experimental info | |||||||||
| Mutagenesis | 143 | 1 | L → P: Impairs interaction with the Elongin BC complex; when associated with F-147. Ref.1 | ||||||
| Mutagenesis | 147 | 1 | C → F: Impairs interaction with the Elongin BC complex; when associated with P-143. Ref.1 | ||||||
| Sequence conflict | 257 | 1 | N → K in BG722466. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Mammalian mediator subunit mMED8 is an Elongin BC-interacting protein that can assemble with Cul2 and Rbx1 to reconstitute a ubiquitin ligase." Brower C.S., Sato S., Tomomori-Sato C., Kamura T., Pause A., Stearman R., Klausner R.D., Malik S., Lane W.S., Sorokina I., Roeder R.G., Conaway J.W., Conaway R.C. Proc. Natl. Acad. Sci. U.S.A. 99:10353-10358(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), IDENTIFICATION IN AN E3 UBIQUITIN LIGASE COMPLEX, INTERACTION WITH MED10, MUTAGENESIS OF LEU-143 AND CYS-147. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-259 (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 5-268 (ISOFORM 2). Tissue: Cervix carcinoma, Melanoma and Testis. |
| [4] | "Composite co-activator ARC mediates chromatin-directed transcriptional activation." Naeaer A.M., Beaurang P.A., Zhou S., Abraham S., Solomon W.B., Tjian R. Nature 398:828-832(1999) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE ARC COMPLEX, PROTEIN SEQUENCE OF 72-83 AND 189-200. |
| [5] | "Identification of mammalian Mediator subunits with similarities to yeast Mediator subunits Srb5, Srb6, Med11, and Rox3." Sato S., Tomomori-Sato C., Banks C.A.S., Sorokina I., Parmely T.J., Kong S.E., Jin J., Cai Y., Lane W.S., Brower C.S., Conaway R.C., Conaway J.W. J. Biol. Chem. 278:15123-15127(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MED10. |
| [6] | "A set of consensus mammalian mediator subunits identified by multidimensional protein identification technology." Sato S., Tomomori-Sato C., Parmely T.J., Florens L., Zybailov B., Swanson S.K., Banks C.A.S., Jin J., Cai Y., Washburn M.P., Conaway J.W., Conaway R.C. Mol. Cell 14:685-691(2004) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE MEDIATOR COMPLEX. |
| [7] | "MED1/TRAP220 exists predominantly in a TRAP/Mediator subpopulation enriched in RNA polymerase II and is required for ER-mediated transcription." Zhang X., Krutchinsky A., Fukuda A., Chen W., Yamamura S., Chait B.T., Roeder R.G. Mol. Cell 19:89-100(2005) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE MEDIATOR COMPLEX, ASSOCIATION OF THE MEDIATOR COMPLEX WITH RNA POLYMERASE II. |
| [8] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-82, MASS SPECTROMETRY. |
| [9] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF521562 mRNA. Translation: AAM76709.1. AL139289 Genomic DNA. Translation: CAI23382.1. AL139289 Genomic DNA. Translation: CAP58853.1. AL139289 Genomic DNA. Translation: CAP58854.1. BC010019 mRNA. Translation: AAH10019.3. BC010543 mRNA. Translation: AAH10543.2. BG722466 mRNA. No translation available. |
| IPI | IPI00300278. IPI00418130. IPI00419516. |
| RefSeq | NP_001001653.1. NM_001001653.2. NP_443109.2. NM_052877.4. NP_963836.2. NM_201542.4. |
| UniGene | Hs.301756. |
3D structure databases | |
| ProteinModelPortal | Q96G25. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96G25. 20 interactions. |
| MINT | MINT-275810. |
| STRING | 9606.ENSP00000290663. |
PTM databases | |
| PhosphoSite | Q96G25. |
Polymorphism databases | |
| DMDM | 31076772. |
Proteomic databases | |
| PaxDb | Q96G25. |
| PRIDE | Q96G25. |
Protocols and materials databases | |
| DNASU | 112950. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000290663; ENSP00000290663; ENSG00000159479. ENST00000372455; ENSP00000361533; ENSG00000159479. ENST00000372457; ENSP00000361535; ENSG00000159479. |
| GeneID | 112950. |
| KEGG | hsa:112950. |
| UCSC | uc001cje.1. human. uc001cjf.4. human. |
Organism-specific databases | |
| CTD | 112950. |
| GeneCards | GC01M043849. |
| HGNC | HGNC:19971. MED8. |
| HPA | HPA028377. HPA028438. |
| MIM | 607956. gene. |
| neXtProt | NX_Q96G25. |
| PharmGKB | PA134893073. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG330005. |
| HOGENOM | HOG000231149. |
| HOVERGEN | HBG009716. |
| InParanoid | Q96G25. |
| KO | K15129. |
| OMA | NWPTFLD. |
| OrthoDB | EOG4CC427. |
Enzyme and pathway databases | |
| Reactome | REACT_111045. Developmental Biology. REACT_71. Gene Expression. |
| UniPathway | UPA00143. |
Gene expression databases | |
| Bgee | Q96G25. |
| CleanEx | HS_MED8. |
| Genevestigator | Q96G25. |
| GermOnline | ENSG00000159479. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019364. Mediatior_Med8_fun/met. [Graphical view] |
| Pfam | PF10232. Med8. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 112950. |
| NextBio | 78721. |
| SOURCE | Search... |
Entry information
| Entry name | MED8_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96G25 Secondary accession number(s): A9IZ91 Q96FQ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
