Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tetraspanin-17

Gene

TSPAN17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

  • enzyme binding Source: UniProtKB
  • ubiquitin-protein transferase activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Tetraspanin-17
Short name:
Tspan-17
Alternative name(s):
F-box only protein 23
Tetraspan protein SB134
Transmembrane 4 superfamily member 17
Gene namesi
Name:TSPAN17
Synonyms:FBXO23, TM4SF17
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:13594. TSPAN17.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 1919CytoplasmicSequence analysisAdd
BLAST
Transmembranei20 – 4021HelicalSequence analysisAdd
BLAST
Topological domaini41 – 6323ExtracellularSequence analysisAdd
BLAST
Transmembranei64 – 8421HelicalSequence analysisAdd
BLAST
Topological domaini85 – 9410CytoplasmicSequence analysis
Transmembranei95 – 11521HelicalSequence analysisAdd
BLAST
Topological domaini116 – 234119ExtracellularSequence analysisAdd
BLAST
Transmembranei235 – 25521HelicalSequence analysisAdd
BLAST
Topological domaini256 – 27015CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

  • integral component of plasma membrane Source: GO_Central
  • ubiquitin ligase complex Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA128394740.

Polymorphism and mutation databases

BioMutaiTSPAN17.
DMDMi147744595.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 270270Tetraspanin-17PRO_0000219265Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi51 – 511N-linked (GlcNAc...)Sequence analysis
Glycosylationi171 – 1711N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ96FV3.
PaxDbiQ96FV3.
PeptideAtlasiQ96FV3.
PRIDEiQ96FV3.

Expressioni

Gene expression databases

BgeeiQ96FV3.
CleanExiHS_TSPAN17.
ExpressionAtlasiQ96FV3. baseline and differential.
GenevisibleiQ96FV3. HS.

Interactioni

GO - Molecular functioni

  • enzyme binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117648. 44 interactions.
IntActiQ96FV3. 3 interactions.
STRINGi9606.ENSP00000309036.

Structurei

3D structure databases

ProteinModelPortaliQ96FV3.
SMRiQ96FV3. Positions 115-165.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the tetraspanin (TM4SF) family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3882. Eukaryota.
ENOG4111IRY. LUCA.
GeneTreeiENSGT00760000118875.
HOGENOMiHOG000230652.
HOVERGENiHBG108605.
InParanoidiQ96FV3.
KOiK10303.
PhylomeDBiQ96FV3.

Family and domain databases

InterProiIPR000301. Tetraspanin.
IPR018499. Tetraspanin/Peripherin.
IPR018503. Tetraspanin_CS.
IPR008952. Tetraspanin_EC2.
[Graphical view]
PfamiPF00335. Tetraspannin. 1 hit.
[Graphical view]
PIRSFiPIRSF002419. Tetraspanin. 1 hit.
PRINTSiPR00259. TMFOUR.
SUPFAMiSSF48652. SSF48652. 1 hit.
PROSITEiPS00421. TM4_1. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FV3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPGKHQHFQE PEVGCCGKYF LFGFNIVFWV LGALFLAIGL WAWGEKGVLS
60 70 80 90 100
NISALTDLGG LDPVWLFVVV GGVMSVLGFA GCIGALRENT FLLKFFSVFL
110 120 130 140 150
GLIFFLELAT GILAFVFKDW IRDQLNLFIN NNVKAYRDDI DLQNLIDFAQ
160 170 180 190 200
EYWSCCGARG PNDWNLNIYF NCTDLNPSRE RCGVPFSCCV RDPAEDVLNT
210 220 230 240 250
QCGYDVRLKL ELEQQGFIHT KGCVGQFEKW LQDNLIVVAG VFMGIALLQI
260 270
FGICLAQNLV SDIKAVKANW
Length:270
Mass (Da):30,264
Last modified:May 15, 2007 - v2
Checksum:i157F76DF059D9E19
GO
Isoform 2 (identifier: Q96FV3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     260-270: VSDIKAVKANW → EQME

Show »
Length:263
Mass (Da):29,569
Checksum:i820189FB903DDB14
GO
Isoform 3 (identifier: Q96FV3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     30-95: Missing.
     153-194: Missing.
     249-249: Q → QVPLWPHVPLPLPGPPSLSPHLSSVLQ

Show »
Length:188
Mass (Da):21,415
Checksum:iD68CC9413038D029
GO
Isoform 4 (identifier: Q96FV3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     270-270: W → WSKWNDDFENHWLTPTISEVLSTAGPQQNSLTGAPGPAPPSRHVFFGLGGLYPEPTFKNW

Show »
Length:329
Mass (Da):36,742
Checksum:i8A7427CFA987ED06
GO

Sequence cautioni

The sequence AAF04524.1 differs from that shown. Reason: Frameshift at positions 66, 81 and 83. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti239 – 2391A → P in AAK67627 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti140 – 1401I → T.
Corresponds to variant rs17624798 [ dbSNP | Ensembl ].
VAR_057278

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei30 – 9566Missing in isoform 3. 1 PublicationVSP_011388Add
BLAST
Alternative sequencei153 – 19442Missing in isoform 3. 1 PublicationVSP_011389Add
BLAST
Alternative sequencei249 – 2491Q → QVPLWPHVPLPLPGPPSLSP HLSSVLQ in isoform 3. 1 PublicationVSP_011390
Alternative sequencei260 – 27011VSDIKAVKANW → EQME in isoform 2. 1 PublicationVSP_011391Add
BLAST
Alternative sequencei270 – 2701W → WSKWNDDFENHWLTPTISEV LSTAGPQQNSLTGAPGPAPP SRHVFFGLGGLYPEPTFKNW in isoform 4. 1 PublicationVSP_025608

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037146 mRNA. Translation: AAK67627.1.
AC091934 Genomic DNA. No translation available.
BC010405 mRNA. Translation: AAH10405.1.
BC067105 mRNA. Translation: AAH67105.1.
AF174603 mRNA. Translation: AAF04524.1. Frameshift.
CCDSiCCDS47346.2. [Q96FV3-3]
CCDS54952.1. [Q96FV3-4]
RefSeqiNP_001006617.2. NM_001006616.2. [Q96FV3-3]
NP_569732.2. NM_130465.4. [Q96FV3-4]
UniGeneiHs.532129.

Genome annotation databases

EnsembliENST00000298564; ENSP00000298564; ENSG00000048140. [Q96FV3-2]
ENST00000508164; ENSP00000422053; ENSG00000048140. [Q96FV3-4]
ENST00000515708; ENSP00000426650; ENSG00000048140. [Q96FV3-3]
GeneIDi26262.
KEGGihsa:26262.
UCSCiuc003mes.4. human. [Q96FV3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY037146 mRNA. Translation: AAK67627.1.
AC091934 Genomic DNA. No translation available.
BC010405 mRNA. Translation: AAH10405.1.
BC067105 mRNA. Translation: AAH67105.1.
AF174603 mRNA. Translation: AAF04524.1. Frameshift.
CCDSiCCDS47346.2. [Q96FV3-3]
CCDS54952.1. [Q96FV3-4]
RefSeqiNP_001006617.2. NM_001006616.2. [Q96FV3-3]
NP_569732.2. NM_130465.4. [Q96FV3-4]
UniGeneiHs.532129.

3D structure databases

ProteinModelPortaliQ96FV3.
SMRiQ96FV3. Positions 115-165.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117648. 44 interactions.
IntActiQ96FV3. 3 interactions.
STRINGi9606.ENSP00000309036.

Polymorphism and mutation databases

BioMutaiTSPAN17.
DMDMi147744595.

Proteomic databases

EPDiQ96FV3.
PaxDbiQ96FV3.
PeptideAtlasiQ96FV3.
PRIDEiQ96FV3.

Protocols and materials databases

DNASUi26262.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298564; ENSP00000298564; ENSG00000048140. [Q96FV3-2]
ENST00000508164; ENSP00000422053; ENSG00000048140. [Q96FV3-4]
ENST00000515708; ENSP00000426650; ENSG00000048140. [Q96FV3-3]
GeneIDi26262.
KEGGihsa:26262.
UCSCiuc003mes.4. human. [Q96FV3-1]

Organism-specific databases

CTDi26262.
GeneCardsiTSPAN17.
HGNCiHGNC:13594. TSPAN17.
neXtProtiNX_Q96FV3.
PharmGKBiPA128394740.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3882. Eukaryota.
ENOG4111IRY. LUCA.
GeneTreeiENSGT00760000118875.
HOGENOMiHOG000230652.
HOVERGENiHBG108605.
InParanoidiQ96FV3.
KOiK10303.
PhylomeDBiQ96FV3.

Miscellaneous databases

GenomeRNAii26262.
PROiQ96FV3.

Gene expression databases

BgeeiQ96FV3.
CleanExiHS_TSPAN17.
ExpressionAtlasiQ96FV3. baseline and differential.
GenevisibleiQ96FV3. HS.

Family and domain databases

InterProiIPR000301. Tetraspanin.
IPR018499. Tetraspanin/Peripherin.
IPR018503. Tetraspanin_CS.
IPR008952. Tetraspanin_EC2.
[Graphical view]
PfamiPF00335. Tetraspannin. 1 hit.
[Graphical view]
PIRSFiPIRSF002419. Tetraspanin. 1 hit.
PRINTSiPR00259. TMFOUR.
SUPFAMiSSF48652. SSF48652. 1 hit.
PROSITEiPS00421. TM4_1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Zhang W., Li N., Wan T., Cao X.
    Submitted (MAY-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
  2. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4).
    Tissue: Mammary gland and Pancreas.
  4. Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-110 (ISOFORMS 1/3/4).

Entry informationi

Entry nameiTSN17_HUMAN
AccessioniPrimary (citable) accession number: Q96FV3
Secondary accession number(s): Q6NXF7, Q96S98, Q9UKB9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: May 15, 2007
Last modified: July 6, 2016
This is version 117 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.