Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Secernin-2

Gene

SCRN2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei12 – 121Sequence analysis

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Protein family/group databases

MEROPSiC69.004.

Names & Taxonomyi

Protein namesi
Recommended name:
Secernin-2
Gene namesi
Name:SCRN2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:30381. SCRN2.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134964266.

Polymorphism and mutation databases

BioMutaiSCRN2.
DMDMi317373511.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 425425Secernin-2PRO_0000262552Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei52 – 521PhosphothreonineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96FV2.
MaxQBiQ96FV2.
PaxDbiQ96FV2.
PRIDEiQ96FV2.

2D gel databases

REPRODUCTION-2DPAGEIPI00062266.

PTM databases

iPTMnetiQ96FV2.
PhosphoSiteiQ96FV2.

Expressioni

Gene expression databases

BgeeiQ96FV2.
CleanExiHS_SCRN2.
ExpressionAtlasiQ96FV2. baseline and differential.
GenevisibleiQ96FV2. HS.

Organism-specific databases

HPAiHPA022934.
HPA023434.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
TINF2Q9BSI42EBI-11306862,EBI-717399

Protein-protein interaction databases

BioGridi124726. 15 interactions.
IntActiQ96FV2. 2 interactions.
MINTiMINT-5001860.
STRINGi9606.ENSP00000290216.

Structurei

3D structure databases

ProteinModelPortaliQ96FV2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410IGQK. Eukaryota.
COG4690. LUCA.
GeneTreeiENSGT00390000013474.
HOGENOMiHOG000223307.
HOVERGENiHBG056050.
InParanoidiQ96FV2.
KOiK14358.
OrthoDBiEOG7W1545.
PhylomeDBiQ96FV2.
TreeFamiTF323890.

Family and domain databases

InterProiIPR005322. Peptidase_C69.
[Graphical view]
PfamiPF03577. Peptidase_C69. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FV2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSSPDSPC SCDCFVSVPP ASAIPAVIFA KNSDRPRDEV QEVVFVPAGT
60 70 80 90 100
HTPGSRLQCT YIEVEQVSKT HAVILSRPSW LWGAEMGANE HGVCIGNEAV
110 120 130 140 150
WTKEPVGEGE ALLGMDLLRL ALERSSSAQE ALHVITGLLE HYGQGGNCLE
160 170 180 190 200
DAAPFSYHST FLLADRTEAW VLETAGRLWA AQRIQEGARN ISNQLSIGTD
210 220 230 240 250
ISAQHPELRT HAQAKGWWDG QGAFDFAQIF SLTQQPVRME AAKARFQAGR
260 270 280 290 300
ELLRQRQGGI TAEVMMGILR DKESGICMDS GGFRTTASMV SVLPQDPTQP
310 320 330 340 350
CVHFLTATPD PSRSVFKPFI FGMGVAQAPQ VLSPTFGAQD PVRTLPRFQT
360 370 380 390 400
QVDRRHTLYR GHQAALGLME RDQDRGQQLQ QKQQDLEQEG LEATQGLLAG
410 420
EWAPPLWELG SLFQAFVKRE SQAYA
Length:425
Mass (Da):46,597
Last modified:January 11, 2011 - v3
Checksum:iAA7A0290D920B359
GO
Isoform 2 (identifier: Q96FV2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     374-425: DRGQQLQQKQQDLEQEGLEATQGLLAGEWAPPLWELGSLFQAFVKRESQAYA → VSPRE

Show »
Length:378
Mass (Da):41,295
Checksum:iC9FDD7516BCB0BF3
GO

Sequence cautioni

The sequence AAH10408.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti103 – 1031K → R.1 Publication
Corresponds to variant rs17856536 [ dbSNP | Ensembl ].
VAR_029509
Natural varianti273 – 2731E → Q.
Corresponds to variant rs35901087 [ dbSNP | Ensembl ].
VAR_035263
Natural varianti323 – 3231M → V.3 Publications
Corresponds to variant rs7350974 [ dbSNP | Ensembl ].
VAR_029510
Natural varianti330 – 3301Q → R.
Corresponds to variant rs34480825 [ dbSNP | Ensembl ].
VAR_035264
Natural varianti411 – 4111S → G.1 Publication
Corresponds to variant rs17856535 [ dbSNP | Ensembl ].
VAR_029511

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei374 – 42552DRGQQ…SQAYA → VSPRE in isoform 2. 2 PublicationsVSP_044566Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290646 mRNA. Translation: BAF83335.1.
AK303835 mRNA. Translation: BAH14063.1.
AC003665 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94791.1.
CH471109 Genomic DNA. Translation: EAW94792.1.
BC002980 mRNA. Translation: AAH02980.1.
BC010408 mRNA. Translation: AAH10408.2. Different initiation.
BC017317 mRNA. Translation: AAH17317.1.
CCDSiCCDS11519.1. [Q96FV2-1]
CCDS45723.1. [Q96FV2-2]
RefSeqiNP_001138495.1. NM_001145023.1. [Q96FV2-2]
NP_612364.2. NM_138355.3. [Q96FV2-1]
XP_005257833.1. XM_005257776.3. [Q96FV2-1]
UniGeneiHs.239718.

Genome annotation databases

EnsembliENST00000290216; ENSP00000290216; ENSG00000141295. [Q96FV2-1]
ENST00000407215; ENSP00000383935; ENSG00000141295. [Q96FV2-2]
GeneIDi90507.
KEGGihsa:90507.
UCSCiuc002imd.4. human. [Q96FV2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290646 mRNA. Translation: BAF83335.1.
AK303835 mRNA. Translation: BAH14063.1.
AC003665 Genomic DNA. No translation available.
CH471109 Genomic DNA. Translation: EAW94791.1.
CH471109 Genomic DNA. Translation: EAW94792.1.
BC002980 mRNA. Translation: AAH02980.1.
BC010408 mRNA. Translation: AAH10408.2. Different initiation.
BC017317 mRNA. Translation: AAH17317.1.
CCDSiCCDS11519.1. [Q96FV2-1]
CCDS45723.1. [Q96FV2-2]
RefSeqiNP_001138495.1. NM_001145023.1. [Q96FV2-2]
NP_612364.2. NM_138355.3. [Q96FV2-1]
XP_005257833.1. XM_005257776.3. [Q96FV2-1]
UniGeneiHs.239718.

3D structure databases

ProteinModelPortaliQ96FV2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124726. 15 interactions.
IntActiQ96FV2. 2 interactions.
MINTiMINT-5001860.
STRINGi9606.ENSP00000290216.

Protein family/group databases

MEROPSiC69.004.

PTM databases

iPTMnetiQ96FV2.
PhosphoSiteiQ96FV2.

Polymorphism and mutation databases

BioMutaiSCRN2.
DMDMi317373511.

2D gel databases

REPRODUCTION-2DPAGEIPI00062266.

Proteomic databases

EPDiQ96FV2.
MaxQBiQ96FV2.
PaxDbiQ96FV2.
PRIDEiQ96FV2.

Protocols and materials databases

DNASUi90507.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000290216; ENSP00000290216; ENSG00000141295. [Q96FV2-1]
ENST00000407215; ENSP00000383935; ENSG00000141295. [Q96FV2-2]
GeneIDi90507.
KEGGihsa:90507.
UCSCiuc002imd.4. human. [Q96FV2-1]

Organism-specific databases

CTDi90507.
GeneCardsiSCRN2.
HGNCiHGNC:30381. SCRN2.
HPAiHPA022934.
HPA023434.
MIMi614966. gene.
neXtProtiNX_Q96FV2.
PharmGKBiPA134964266.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGQK. Eukaryota.
COG4690. LUCA.
GeneTreeiENSGT00390000013474.
HOGENOMiHOG000223307.
HOVERGENiHBG056050.
InParanoidiQ96FV2.
KOiK14358.
OrthoDBiEOG7W1545.
PhylomeDBiQ96FV2.
TreeFamiTF323890.

Miscellaneous databases

GenomeRNAii90507.
PROiQ96FV2.
SOURCEiSearch...

Gene expression databases

BgeeiQ96FV2.
CleanExiHS_SCRN2.
ExpressionAtlasiQ96FV2. baseline and differential.
GenevisibleiQ96FV2. HS.

Family and domain databases

InterProiIPR005322. Peptidase_C69.
[Graphical view]
PfamiPF03577. Peptidase_C69. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT VAL-323.
    Tissue: Embryo and Ovary.
  2. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT VAL-323.
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANTS ARG-103; VAL-323 AND GLY-411.
    Tissue: Lung and Skin.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-52, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiSCRN2_HUMAN
AccessioniPrimary (citable) accession number: Q96FV2
Secondary accession number(s): A8K3N1
, B7Z8S7, E9PBV5, Q96AC3, Q9BU04
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: January 11, 2011
Last modified: June 8, 2016
This is version 106 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. Peptidase families
    Classification of peptidase families and list of entries
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.