Q96FL9 (GLT14_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 105.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Polypeptide N-acetylgalactosaminyltransferase 14 EC=2.4.1.41 Alternative name(s): Polypeptide GalNAc transferase 14 Short name=GalNAc-T14 Short name=pp-GaNTase 14 Protein-UDP acetylgalactosaminyltransferase 14 UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 552 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney. |
| Catalytic activity | UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide. Ref.1 |
| Cofactor | Manganese By similarity. Calcium By similarity. |
| Pathway | |
| Subcellular location | Golgi apparatus membrane; Single-pass type II membrane protein By similarity. |
| Tissue specificity | Highly expressed in fetal and adult kidney. Widely expressed at low level. Weakly expressed in whole brain, cerebellum, thymus, lung, mammary gland, liver, stomach, small intestine, colon, pancreas, spleen, bladder, uterus, placenta, testis, ovary, skeletal muscle, leukocyte, B-cell, bone marrow, fetal brain, fetal thymus, fetal lung, fetal liver, fetal small intestine, fetal spleen, fetal skeletal and fetus. Ref.1 |
| Domain | There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity. The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity. |
| Sequence similarities | Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily. Contains 1 ricin B-type lectin domain. |
| Sequence caution | The sequence BAB14795.1 differs from that shown. Reason: Chimeric at the C-terminus. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Golgi apparatus Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Calcium Lectin Manganese |
| Molecular function | Glycosyltransferase Transferase |
| PTM | Disulfide bond |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | O-glycan processing Traceable author statement. Source: Reactome post-translational protein modificationTraceable author statement. Source: Reactome |
| Cellular_component | Golgi membrane Traceable author statement. Source: Reactome integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Molecular_function | polypeptide N-acetylgalactosaminyltransferase activity Inferred from electronic annotation. Source: EC |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96FL9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform 2 (identifier: Q96FL9-2) The sequence of this isoform differs from the canonical sequence as follows: 100-132: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96FL9-3) The sequence of this isoform differs from the canonical sequence as follows: 44-99: PSDADWDDLW...NRAIPDTRHL → VWSLFFKVAG...HLQTQVFLQV | ||||||
| Note: Minor isoform. | ||||||
| Isoform 4 (identifier: Q96FL9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-43: MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPK → MSFPMSLARSSVPFADSGLSSSQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 552 | 552 | Polypeptide N-acetylgalactosaminyltransferase 14 | PRO_0000059133 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 6 | 6 | Cytoplasmic Potential | ||||||||
| Transmembrane | 7 – 26 | 20 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 27 – 552 | 526 | Lumenal Potential | ||||||||
| Domain | 415 – 550 | 136 | Ricin B-type lectin | ||||||||
| Region | 110 – 215 | 106 | Catalytic subdomain A | ||||||||
| Region | 274 – 336 | 63 | Catalytic subdomain B | ||||||||
Amino acid modifications | |||||||||||
| Disulfide bond | 430 ↔ 449 | By similarity | |||||||||
| Disulfide bond | 476 ↔ 493 | By similarity | |||||||||
| Disulfide bond | 517 ↔ 538 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 43 | 43 | MRRLT…VQTPK → MSFPMSLARSSVPFADSGLS SSQ in isoform 4. | VSP_045121 | |||||||
| Alternative sequence | 44 – 99 | 56 | PSDAD…DTRHL → VWSLFFKVAGMSPWAPQVPV SPTPPYQRGHLPTGGHLAVC HFPCLLQEAQFHLQTQVFLQ V in isoform 3. | VSP_011221 | |||||||
| Alternative sequence | 100 – 132 | 33 | Missing in isoform 2. | VSP_011222 | |||||||
| Natural variant | 469 | 1 | Q → K. Corresponds to variant rs2288101 [ dbSNP | Ensembl ]. | VAR_033948 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 368 | 1 | Q → R in BAB14795. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14." Wang H., Tachibana K., Zhang Y., Iwasaki H., Kameyama A., Chen L., Guo J.-M., Hiruma T., Togayachi A., Kudo T., Kikuchi N., Narimatsu H. Biochem. Biophys. Res. Commun. 300:738-744(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, ALTERNATIVE SPLICING, TISSUE SPECIFICITY. Tissue: Stomach. |
| [2] | Wandall H.H., Bennett E.P. Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [3] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-435 (ISOFORM 2). Tissue: Fibroblast, Retinoblastoma and Teratocarcinoma. |
| [5] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Eye and Ovary. |
| + | Additional computationally mapped references. |
Web resources
| GGDB GlycoGene database |
| Functional Glycomics Gateway - GTase Polypeptide N-acetylgalactosaminyltransferase 14 |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB078144 mRNA. Translation: BAC56889.1. Y09324 mRNA. Translation: CAA70505.4. AY358758 mRNA. Translation: AAQ89118.1. AK022753 mRNA. Translation: BAB14227.1. AK024039 mRNA. Translation: BAB14795.1. Sequence problems. AK091313 mRNA. Translation: BAC03634.1. AK122747 mRNA. Translation: BAG53701.1. AC009301 Genomic DNA. Translation: AAX88899.1. AC009305 Genomic DNA. Translation: AAX93209.1. AC015980 Genomic DNA. Translation: AAY24301.1. CH471053 Genomic DNA. Translation: EAX00489.1. BC006269 mRNA. Translation: AAH06269.2. BC010659 mRNA. Translation: AAH10659.1. |
| IPI | IPI00041868. IPI00101384. IPI00456717. |
| RefSeq | NP_001240755.1. NM_001253826.1. NP_001240756.1. NM_001253827.1. NP_078848.2. NM_024572.3. |
| UniGene | Hs.468058. |
3D structure databases | |
| ProteinModelPortal | Q96FL9. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000288988. |
Protein family/group databases | |
| CAZy | CBM13. Carbohydrate-Binding Module Family 13. GT27. Glycosyltransferase Family 27. |
PTM databases | |
| PhosphoSite | Q96FL9. |
Polymorphism databases | |
| DMDM | 51316071. |
Proteomic databases | |
| PaxDb | Q96FL9. |
| PRIDE | Q96FL9. |
Protocols and materials databases | |
| DNASU | 79623. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000324589; ENSP00000314500; ENSG00000158089. ENST00000349752; ENSP00000288988; ENSG00000158089. ENST00000356174; ENSP00000348497; ENSG00000158089. ENST00000406653; ENSP00000385435; ENSG00000158089. |
| GeneID | 79623. |
| KEGG | hsa:79623. |
| UCSC | uc002rnr.3. human. uc002rns.3. human. uc010ezo.2. human. |
Organism-specific databases | |
| CTD | 79623. |
| GeneCards | GC02M031044. |
| HGNC | HGNC:22946. GALNT14. |
| HPA | HPA010785. |
| MIM | 608225. gene. |
| neXtProt | NX_Q96FL9. |
| PharmGKB | PA134920089. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG239675. |
| HOVERGEN | HBG051699. |
| KO | K00710. |
| OMA | DWDDLWD. |
| OrthoDB | EOG483D4C. |
Enzyme and pathway databases | |
| Reactome | REACT_17015. Metabolism of proteins. |
| UniPathway | UPA00378. |
Gene expression databases | |
| ArrayExpress | Q96FL9. |
| Bgee | Q96FL9. |
| CleanEx | HS_GALNT14. |
| Genevestigator | Q96FL9. |
| GermOnline | ENSG00000158089. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR003859. Galactosyl_T_2_met. IPR001173. Glyco_trans_2. IPR000772. Ricin_B_lectin. [Graphical view] |
| Pfam | PF02709. Glyco_transf_7C. 1 hit. PF00535. Glycos_transf_2. 1 hit. PF00652. Ricin_B_lectin. 1 hit. [Graphical view] |
| SMART | SM00458. RICIN. 1 hit. [Graphical view] |
| SUPFAM | SSF50370. RicinB_like. 1 hit. |
| PROSITE | PS50231. RICIN_B_LECTIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | GALNT14. human. |
| GenomeRNAi | 79623. |
| NextBio | 68697. |
| SOURCE | Search... |
Entry information
| Entry name | GLT14_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96FL9 Secondary accession number(s): B3KV89 Q9H9J8 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| SIMILARITY comments Index of protein domains and families |

Clusters with
