Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Polypeptide N-acetylgalactosaminyltransferase 14

Gene

GALNT14

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney.

Catalytic activityi

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.1 Publication

Cofactori

Mn2+By similarity

Pathwayi: protein glycosylation

This protein is involved in the pathway protein glycosylation, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein glycosylation and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei151SubstrateBy similarity1
Binding sitei176SubstrateBy similarity1
Metal bindingi199ManganeseBy similarity1
Binding sitei200SubstrateBy similarity1
Metal bindingi201ManganeseBy similarity1
Binding sitei305SubstrateBy similarity1
Metal bindingi333ManganeseBy similarity1
Binding sitei336SubstrateBy similarity1
Binding sitei339SubstrateBy similarity1
Binding sitei341SubstrateBy similarity1

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGlycosyltransferase, Transferase
LigandLectin, Manganese, Metal-binding

Enzyme and pathway databases

BRENDAi2.4.1.41 2681
ReactomeiR-HSA-913709 O-linked glycosylation of mucins
UniPathwayiUPA00378

Protein family/group databases

CAZyiCBM13 Carbohydrate-Binding Module Family 13
GT27 Glycosyltransferase Family 27

Names & Taxonomyi

Protein namesi
Recommended name:
Polypeptide N-acetylgalactosaminyltransferase 14 (EC:2.4.1.41)
Alternative name(s):
Polypeptide GalNAc transferase 14
Short name:
GalNAc-T14
Short name:
pp-GaNTase 14
Protein-UDP acetylgalactosaminyltransferase 14
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
Gene namesi
Name:GALNT14
ORF Names:UNQ2434/PRO4994
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000158089.14
HGNCiHGNC:22946 GALNT14
MIMi608225 gene
neXtProtiNX_Q96FL9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 6CytoplasmicSequence analysis6
Transmembranei7 – 26Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST20
Topological domaini27 – 552LumenalSequence analysisAdd BLAST526

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi79623
OpenTargetsiENSG00000158089
PharmGKBiPA134920089

Polymorphism and mutation databases

BioMutaiGALNT14
DMDMi51316071

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000591331 – 552Polypeptide N-acetylgalactosaminyltransferase 14Add BLAST552

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi101 ↔ 328PROSITE-ProRule annotation
Disulfide bondi319 ↔ 397PROSITE-ProRule annotation
Disulfide bondi430 ↔ 449PROSITE-ProRule annotation
Disulfide bondi476 ↔ 493PROSITE-ProRule annotation
Disulfide bondi517 ↔ 538PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiQ96FL9
PaxDbiQ96FL9
PeptideAtlasiQ96FL9
PRIDEiQ96FL9
ProteomicsDBi76541
76542 [Q96FL9-2]
76543 [Q96FL9-3]

PTM databases

iPTMnetiQ96FL9
PhosphoSitePlusiQ96FL9

Expressioni

Tissue specificityi

Detected in renal tubules (at protein level). Highly expressed in fetal and adult kidney. Widely expressed at low level. Weakly expressed in whole brain, cerebellum, thymus, lung, mammary gland, liver, stomach, small intestine, colon, pancreas, spleen, bladder, uterus, placenta, testis, ovary, skeletal muscle, leukocyte, B-cell, bone marrow, fetal brain, fetal thymus, fetal lung, fetal liver, fetal small intestine, fetal spleen, fetal skeletal and fetus. Detected in renal tubules (at protein level).2 Publications

Gene expression databases

BgeeiENSG00000158089
CleanExiHS_GALNT14
ExpressionAtlasiQ96FL9 baseline and differential
GenevisibleiQ96FL9 HS

Organism-specific databases

HPAiHPA030138

Interactioni

Protein-protein interaction databases

BioGridi122753, 4 interactors
STRINGi9606.ENSP00000288988

Structurei

3D structure databases

ProteinModelPortaliQ96FL9
SMRiQ96FL9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini415 – 550Ricin B-type lectinPROSITE-ProRule annotationAdd BLAST136

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni110 – 215Catalytic subdomain AAdd BLAST106
Regioni274 – 336Catalytic subdomain BAdd BLAST63

Domaini

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3738 Eukaryota
ENOG410XPRX LUCA
GeneTreeiENSGT00760000118828
HOVERGENiHBG051699
InParanoidiQ96FL9
KOiK00710
OMAiDWDDLWD
OrthoDBiEOG091G085O
PhylomeDBiQ96FL9
TreeFamiTF313267

Family and domain databases

CDDicd00161 RICIN, 1 hit
Gene3Di3.90.550.10, 1 hit
InterProiView protein in InterPro
IPR001173 Glyco_trans_2-like
IPR029044 Nucleotide-diphossugar_trans
IPR035992 Ricin_B-like_lectins
IPR000772 Ricin_B_lectin
PfamiView protein in Pfam
PF00535 Glycos_transf_2, 1 hit
PF00652 Ricin_B_lectin, 1 hit
SMARTiView protein in SMART
SM00458 RICIN, 1 hit
SUPFAMiSSF50370 SSF50370, 1 hit
SSF53448 SSF53448, 1 hit
PROSITEiView protein in PROSITE
PS50231 RICIN_B_LECTIN, 1 hit

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FL9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRLTRRLVL PVFGVLWITV LLFFWVTKRK LEVPTGPEVQ TPKPSDADWD
60 70 80 90 100
DLWDQFDERR YLNAKKWRVG DDPYKLYAFN QRESERISSN RAIPDTRHLR
110 120 130 140 150
CTLLVYCTDL PPTSIIITFH NEARSTLLRT IRSVLNRTPT HLIREIILVD
160 170 180 190 200
DFSNDPDDCK QLIKLPKVKC LRNNERQGLV RSRIRGADIA QGTTLTFLDS
210 220 230 240 250
HCEVNRDWLQ PLLHRVKEDY TRVVCPVIDI INLDTFTYIE SASELRGGFD
260 270 280 290 300
WSLHFQWEQL SPEQKARRLD PTEPIRTPII AGGLFVIDKA WFDYLGKYDM
310 320 330 340 350
DMDIWGGENF EISFRVWMCG GSLEIVPCSR VGHVFRKKHP YVFPDGNANT
360 370 380 390 400
YIKNTKRTAE VWMDEYKQYY YAARPFALER PFGNVESRLD LRKNLRCQSF
410 420 430 440 450
KWYLENIYPE LSIPKESSIQ KGNIRQRQKC LESQRQNNQE TPNLKLSPCA
460 470 480 490 500
KVKGEDAKSQ VWAFTYTQQI LQEELCLSVI TLFPGAPVVL VLCKNGDDRQ
510 520 530 540 550
QWTKTGSHIE HIASHLCLDT DMFGDGTENG KEIVVNPCES SLMSQHWDMV

SS
Note: Major isoform.
Length:552
Mass (Da):64,321
Last modified:December 1, 2001 - v1
Checksum:i6F2ABAA89F482696
GO
Isoform 2 (identifier: Q96FL9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     100-132: Missing.

Note: No experimental confirmation available.
Show »
Length:519
Mass (Da):60,520
Checksum:i9028631165BC7C08
GO
Isoform 3 (identifier: Q96FL9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-99: PSDADWDDLW...NRAIPDTRHL → VWSLFFKVAG...HLQTQVFLQV

Note: Minor isoform.
Show »
Length:557
Mass (Da):64,289
Checksum:i6968DC02A2AAF2F4
GO
Isoform 4 (identifier: Q96FL9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPK → MSFPMSLARSSVPFADSGLSSSQ

Show »
Length:532
Mass (Da):61,588
Checksum:i685DB05D5597341F
GO

Sequence cautioni

The sequence BAB14795 differs from that shown. Chimeric at the C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti368Q → R in BAB14795 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033948469Q → K. Corresponds to variant dbSNP:rs2288101Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0451211 – 43MRRLT…VQTPK → MSFPMSLARSSVPFADSGLS SSQ in isoform 4. 1 PublicationAdd BLAST43
Alternative sequenceiVSP_01122144 – 99PSDAD…DTRHL → VWSLFFKVAGMSPWAPQVPV SPTPPYQRGHLPTGGHLAVC HFPCLLQEAQFHLQTQVFLQ V in isoform 3. 1 PublicationAdd BLAST56
Alternative sequenceiVSP_011222100 – 132Missing in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB078144 mRNA Translation: BAC56889.1
Y09324 mRNA Translation: CAA70505.4
AY358758 mRNA Translation: AAQ89118.1
AK022753 mRNA Translation: BAB14227.1
AK024039 mRNA Translation: BAB14795.1 Sequence problems.
AK091313 mRNA Translation: BAC03634.1
AK122747 mRNA Translation: BAG53701.1
AC009301 Genomic DNA Translation: AAX88899.1
AC009305 Genomic DNA Translation: AAX93209.1
AC015980 Genomic DNA Translation: AAY24301.1
CH471053 Genomic DNA Translation: EAX00489.1
BC006269 mRNA Translation: AAH06269.2
BC010659 mRNA Translation: AAH10659.1
CCDSiCCDS1773.2 [Q96FL9-1]
CCDS58705.1 [Q96FL9-4]
CCDS58706.1 [Q96FL9-3]
RefSeqiNP_001240755.1, NM_001253826.1 [Q96FL9-3]
NP_001240756.1, NM_001253827.1 [Q96FL9-4]
NP_001316024.1, NM_001329095.1
NP_001316025.1, NM_001329096.1 [Q96FL9-4]
NP_078848.2, NM_024572.3 [Q96FL9-1]
UniGeneiHs.468058
Hs.733100

Genome annotation databases

EnsembliENST00000324589; ENSP00000314500; ENSG00000158089 [Q96FL9-3]
ENST00000349752; ENSP00000288988; ENSG00000158089 [Q96FL9-1]
ENST00000406653; ENSP00000385435; ENSG00000158089 [Q96FL9-4]
GeneIDi79623
KEGGihsa:79623
UCSCiuc002rnq.4 human [Q96FL9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiGLT14_HUMAN
AccessioniPrimary (citable) accession number: Q96FL9
Secondary accession number(s): B3KV89
, Q4ZG75, Q53SU1, Q53TJ0, Q8IVI4, Q9BRH1, Q9H827, Q9H9J8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: December 1, 2001
Last modified: June 20, 2018
This is version 142 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health