Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96FL9

- GLT14_HUMAN

UniProt

Q96FL9 - GLT14_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Polypeptide N-acetylgalactosaminyltransferase 14

Gene

GALNT14

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney.

Catalytic activityi

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide.1 Publication

Cofactori

Manganese.By similarity

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei151 – 1511SubstrateBy similarity
Binding sitei176 – 1761SubstrateBy similarity
Metal bindingi199 – 1991ManganeseBy similarity
Binding sitei200 – 2001SubstrateBy similarity
Metal bindingi201 – 2011ManganeseBy similarity
Binding sitei305 – 3051SubstrateBy similarity
Metal bindingi333 – 3331ManganeseBy similarity
Binding sitei336 – 3361SubstrateBy similarity
Binding sitei339 – 3391SubstrateBy similarity
Binding sitei341 – 3411SubstrateBy similarity

GO - Molecular functioni

  1. carbohydrate binding Source: UniProtKB-KW
  2. metal ion binding Source: UniProtKB-KW
  3. polypeptide N-acetylgalactosaminyltransferase activity Source: UniProtKB-EC

GO - Biological processi

  1. cellular protein metabolic process Source: Reactome
  2. O-glycan processing Source: Reactome
  3. post-translational protein modification Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Glycosyltransferase, Transferase

Keywords - Ligandi

Lectin, Manganese, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_115606. O-linked glycosylation of mucins.
UniPathwayiUPA00378.

Protein family/group databases

CAZyiCBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

Names & Taxonomyi

Protein namesi
Recommended name:
Polypeptide N-acetylgalactosaminyltransferase 14 (EC:2.4.1.41)
Alternative name(s):
Polypeptide GalNAc transferase 14
Short name:
GalNAc-T14
Short name:
pp-GaNTase 14
Protein-UDP acetylgalactosaminyltransferase 14
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
Gene namesi
Name:GALNT14
ORF Names:UNQ2434/PRO4994
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:22946. GALNT14.

Subcellular locationi

GO - Cellular componenti

  1. Golgi membrane Source: Reactome
  2. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134920089.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 552552Polypeptide N-acetylgalactosaminyltransferase 14PRO_0000059133Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi101 ↔ 328PROSITE-ProRule annotation
Disulfide bondi319 ↔ 397PROSITE-ProRule annotation
Disulfide bondi430 ↔ 449PROSITE-ProRule annotation
Disulfide bondi476 ↔ 493PROSITE-ProRule annotation
Disulfide bondi517 ↔ 538PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiQ96FL9.
PaxDbiQ96FL9.
PRIDEiQ96FL9.

PTM databases

PhosphoSiteiQ96FL9.

Expressioni

Tissue specificityi

Detected in renal tubules (at protein level). Highly expressed in fetal and adult kidney. Widely expressed at low level. Weakly expressed in whole brain, cerebellum, thymus, lung, mammary gland, liver, stomach, small intestine, colon, pancreas, spleen, bladder, uterus, placenta, testis, ovary, skeletal muscle, leukocyte, B-cell, bone marrow, fetal brain, fetal thymus, fetal lung, fetal liver, fetal small intestine, fetal spleen, fetal skeletal and fetus. Detected in renal tubules (at protein level).2 Publications

Gene expression databases

BgeeiQ96FL9.
CleanExiHS_GALNT14.
ExpressionAtlasiQ96FL9. baseline and differential.
GenevestigatoriQ96FL9.

Organism-specific databases

HPAiHPA010785.

Interactioni

Protein-protein interaction databases

BioGridi122753. 4 interactions.
STRINGi9606.ENSP00000288988.

Structurei

3D structure databases

ProteinModelPortaliQ96FL9.
SMRiQ96FL9. Positions 53-547.
ModBaseiSearch...
MobiDBiSearch...

Topological domain

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 66CytoplasmicSequence Analysis
Topological domaini27 – 552526LumenalSequence AnalysisAdd
BLAST

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei7 – 2620Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
BLAST

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini415 – 550136Ricin B-type lectinPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni110 – 215106Catalytic subdomain AAdd
BLAST
Regioni274 – 33663Catalytic subdomain BAdd
BLAST

Domaini

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding.By similarity
The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity.By similarity

Sequence similaritiesi

Contains 1 ricin B-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG239675.
GeneTreeiENSGT00760000118828.
HOVERGENiHBG051699.
InParanoidiQ96FL9.
KOiK00710.
OMAiHEPEATN.
OrthoDBiEOG7J9VP2.
PhylomeDBiQ96FL9.
TreeFamiTF313267.

Family and domain databases

Gene3Di3.90.550.10. 1 hit.
InterProiIPR027791. Galactosyl_T_C.
IPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view]
PfamiPF02709. Glyco_transf_7C. 1 hit.
PF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view]
SMARTiSM00458. RICIN. 1 hit.
[Graphical view]
SUPFAMiSSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEiPS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96FL9-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRRLTRRLVL PVFGVLWITV LLFFWVTKRK LEVPTGPEVQ TPKPSDADWD
60 70 80 90 100
DLWDQFDERR YLNAKKWRVG DDPYKLYAFN QRESERISSN RAIPDTRHLR
110 120 130 140 150
CTLLVYCTDL PPTSIIITFH NEARSTLLRT IRSVLNRTPT HLIREIILVD
160 170 180 190 200
DFSNDPDDCK QLIKLPKVKC LRNNERQGLV RSRIRGADIA QGTTLTFLDS
210 220 230 240 250
HCEVNRDWLQ PLLHRVKEDY TRVVCPVIDI INLDTFTYIE SASELRGGFD
260 270 280 290 300
WSLHFQWEQL SPEQKARRLD PTEPIRTPII AGGLFVIDKA WFDYLGKYDM
310 320 330 340 350
DMDIWGGENF EISFRVWMCG GSLEIVPCSR VGHVFRKKHP YVFPDGNANT
360 370 380 390 400
YIKNTKRTAE VWMDEYKQYY YAARPFALER PFGNVESRLD LRKNLRCQSF
410 420 430 440 450
KWYLENIYPE LSIPKESSIQ KGNIRQRQKC LESQRQNNQE TPNLKLSPCA
460 470 480 490 500
KVKGEDAKSQ VWAFTYTQQI LQEELCLSVI TLFPGAPVVL VLCKNGDDRQ
510 520 530 540 550
QWTKTGSHIE HIASHLCLDT DMFGDGTENG KEIVVNPCES SLMSQHWDMV

SS

Note: Major isoform.

Length:552
Mass (Da):64,321
Last modified:December 1, 2001 - v1
Checksum:i6F2ABAA89F482696
GO
Isoform 2 (identifier: Q96FL9-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     100-132: Missing.

Note: No experimental confirmation available.

Show »
Length:519
Mass (Da):60,520
Checksum:i9028631165BC7C08
GO
Isoform 3 (identifier: Q96FL9-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     44-99: PSDADWDDLW...NRAIPDTRHL → VWSLFFKVAG...HLQTQVFLQV

Note: Minor isoform.

Show »
Length:557
Mass (Da):64,289
Checksum:i6968DC02A2AAF2F4
GO
Isoform 4 (identifier: Q96FL9-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPK → MSFPMSLARSSVPFADSGLSSSQ

Show »
Length:532
Mass (Da):61,588
Checksum:i685DB05D5597341F
GO

Sequence cautioni

The sequence BAB14795.1 differs from that shown. Reason: Chimeric at the C-terminus.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti368 – 3681Q → R in BAB14795. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti469 – 4691Q → K.
Corresponds to variant rs2288101 [ dbSNP | Ensembl ].
VAR_033948

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4343MRRLT…VQTPK → MSFPMSLARSSVPFADSGLS SSQ in isoform 4. 1 PublicationVSP_045121Add
BLAST
Alternative sequencei44 – 9956PSDAD…DTRHL → VWSLFFKVAGMSPWAPQVPV SPTPPYQRGHLPTGGHLAVC HFPCLLQEAQFHLQTQVFLQ V in isoform 3. 1 PublicationVSP_011221Add
BLAST
Alternative sequencei100 – 13233Missing in isoform 2. 1 PublicationVSP_011222Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB078144 mRNA. Translation: BAC56889.1.
Y09324 mRNA. Translation: CAA70505.4.
AY358758 mRNA. Translation: AAQ89118.1.
AK022753 mRNA. Translation: BAB14227.1.
AK024039 mRNA. Translation: BAB14795.1. Sequence problems.
AK091313 mRNA. Translation: BAC03634.1.
AK122747 mRNA. Translation: BAG53701.1.
AC009301 Genomic DNA. Translation: AAX88899.1.
AC009305 Genomic DNA. Translation: AAX93209.1.
AC015980 Genomic DNA. Translation: AAY24301.1.
CH471053 Genomic DNA. Translation: EAX00489.1.
BC006269 mRNA. Translation: AAH06269.2.
BC010659 mRNA. Translation: AAH10659.1.
CCDSiCCDS1773.2. [Q96FL9-1]
CCDS58705.1. [Q96FL9-4]
CCDS58706.1. [Q96FL9-3]
RefSeqiNP_001240755.1. NM_001253826.1. [Q96FL9-3]
NP_001240756.1. NM_001253827.1. [Q96FL9-4]
NP_078848.2. NM_024572.3. [Q96FL9-1]
UniGeneiHs.468058.

Genome annotation databases

EnsembliENST00000324589; ENSP00000314500; ENSG00000158089. [Q96FL9-3]
ENST00000349752; ENSP00000288988; ENSG00000158089. [Q96FL9-1]
ENST00000406653; ENSP00000385435; ENSG00000158089. [Q96FL9-4]
GeneIDi79623.
KEGGihsa:79623.
UCSCiuc002rnq.3. human.
uc002rnr.3. human. [Q96FL9-1]
uc002rns.3. human. [Q96FL9-3]
uc010ezo.2. human. [Q96FL9-2]

Polymorphism databases

DMDMi51316071.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

GGDB

GlycoGene database

Functional Glycomics Gateway - GTase

Polypeptide N-acetylgalactosaminyltransferase 14

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB078144 mRNA. Translation: BAC56889.1 .
Y09324 mRNA. Translation: CAA70505.4 .
AY358758 mRNA. Translation: AAQ89118.1 .
AK022753 mRNA. Translation: BAB14227.1 .
AK024039 mRNA. Translation: BAB14795.1 . Sequence problems.
AK091313 mRNA. Translation: BAC03634.1 .
AK122747 mRNA. Translation: BAG53701.1 .
AC009301 Genomic DNA. Translation: AAX88899.1 .
AC009305 Genomic DNA. Translation: AAX93209.1 .
AC015980 Genomic DNA. Translation: AAY24301.1 .
CH471053 Genomic DNA. Translation: EAX00489.1 .
BC006269 mRNA. Translation: AAH06269.2 .
BC010659 mRNA. Translation: AAH10659.1 .
CCDSi CCDS1773.2. [Q96FL9-1 ]
CCDS58705.1. [Q96FL9-4 ]
CCDS58706.1. [Q96FL9-3 ]
RefSeqi NP_001240755.1. NM_001253826.1. [Q96FL9-3 ]
NP_001240756.1. NM_001253827.1. [Q96FL9-4 ]
NP_078848.2. NM_024572.3. [Q96FL9-1 ]
UniGenei Hs.468058.

3D structure databases

ProteinModelPortali Q96FL9.
SMRi Q96FL9. Positions 53-547.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122753. 4 interactions.
STRINGi 9606.ENSP00000288988.

Protein family/group databases

CAZyi CBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

PTM databases

PhosphoSitei Q96FL9.

Polymorphism databases

DMDMi 51316071.

Proteomic databases

MaxQBi Q96FL9.
PaxDbi Q96FL9.
PRIDEi Q96FL9.

Protocols and materials databases

DNASUi 79623.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000324589 ; ENSP00000314500 ; ENSG00000158089 . [Q96FL9-3 ]
ENST00000349752 ; ENSP00000288988 ; ENSG00000158089 . [Q96FL9-1 ]
ENST00000406653 ; ENSP00000385435 ; ENSG00000158089 . [Q96FL9-4 ]
GeneIDi 79623.
KEGGi hsa:79623.
UCSCi uc002rnq.3. human.
uc002rnr.3. human. [Q96FL9-1 ]
uc002rns.3. human. [Q96FL9-3 ]
uc010ezo.2. human. [Q96FL9-2 ]

Organism-specific databases

CTDi 79623.
GeneCardsi GC02M031044.
HGNCi HGNC:22946. GALNT14.
HPAi HPA010785.
MIMi 608225. gene.
neXtProti NX_Q96FL9.
PharmGKBi PA134920089.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG239675.
GeneTreei ENSGT00760000118828.
HOVERGENi HBG051699.
InParanoidi Q96FL9.
KOi K00710.
OMAi HEPEATN.
OrthoDBi EOG7J9VP2.
PhylomeDBi Q96FL9.
TreeFami TF313267.

Enzyme and pathway databases

UniPathwayi UPA00378 .
Reactomei REACT_115606. O-linked glycosylation of mucins.

Miscellaneous databases

ChiTaRSi GALNT14. human.
GeneWikii GALNT14.
GenomeRNAii 79623.
NextBioi 68697.
PROi Q96FL9.
SOURCEi Search...

Gene expression databases

Bgeei Q96FL9.
CleanExi HS_GALNT14.
ExpressionAtlasi Q96FL9. baseline and differential.
Genevestigatori Q96FL9.

Family and domain databases

Gene3Di 3.90.550.10. 1 hit.
InterProi IPR027791. Galactosyl_T_C.
IPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view ]
Pfami PF02709. Glyco_transf_7C. 1 hit.
PF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view ]
SMARTi SM00458. RICIN. 1 hit.
[Graphical view ]
SUPFAMi SSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEi PS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14."
    Wang H., Tachibana K., Zhang Y., Iwasaki H., Kameyama A., Chen L., Guo J.-M., Hiruma T., Togayachi A., Kudo T., Kikuchi N., Narimatsu H.
    Biochem. Biophys. Res. Commun. 300:738-744(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
    Tissue: Stomach.
  2. Wandall H.H., Bennett E.P.
    Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-435 (ISOFORM 2).
    Tissue: Fibroblast, Retinoblastoma and Teratocarcinoma.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Eye and Ovary.
  8. "Development of immunohistochemistry assays to assess GALNT14 and FUT3/6 in clinical trials of dulanermin and drozitumab."
    Stern H.M., Padilla M., Wagner K., Amler L., Ashkenazi A.
    Clin. Cancer Res. 16:1587-1596(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.

Entry informationi

Entry nameiGLT14_HUMAN
AccessioniPrimary (citable) accession number: Q96FL9
Secondary accession number(s): B3KV89
, Q4ZG75, Q53SU1, Q53TJ0, Q8IVI4, Q9BRH1, Q9H827, Q9H9J8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: December 1, 2001
Last modified: October 29, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3