Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96FL9 (GLT14_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Polypeptide N-acetylgalactosaminyltransferase 14

EC=2.4.1.41
Alternative name(s):
Polypeptide GalNAc transferase 14
Short name=GalNAc-T14
Short name=pp-GaNTase 14
Protein-UDP acetylgalactosaminyltransferase 14
UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
Gene names
Name:GALNT14
ORF Names:UNQ2434/PRO4994
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length552 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays activity toward mucin-derived peptide substrates such as Muc2, Muc5AC, Muc7, and Muc13 (-58). May be involved in O-glycosylation in kidney.

Catalytic activity

UDP-N-acetyl-alpha-D-galactosamine + polypeptide = UDP + N-acetyl-alpha-D-galactosaminyl-polypeptide. Ref.1

Cofactor

Manganese By similarity.

Pathway

Protein modification; protein glycosylation.

Subcellular location

Golgi apparatus membrane; Single-pass type II membrane protein By similarity.

Tissue specificity

Detected in renal tubules (at protein level). Highly expressed in fetal and adult kidney. Widely expressed at low level. Weakly expressed in whole brain, cerebellum, thymus, lung, mammary gland, liver, stomach, small intestine, colon, pancreas, spleen, bladder, uterus, placenta, testis, ovary, skeletal muscle, leukocyte, B-cell, bone marrow, fetal brain, fetal thymus, fetal lung, fetal liver, fetal small intestine, fetal spleen, fetal skeletal and fetus. Detected in renal tubules (at protein level). Ref.1 Ref.8

Domain

There are two conserved domains in the glycosyltransferase region: the N-terminal domain (domain A, also called GT1 motif), which is probably involved in manganese coordination and substrate binding and the C-terminal domain (domain B, also called Gal/GalNAc-T motif), which is probably involved in catalytic reaction and UDP-Gal binding By similarity.

The ricin B-type lectin domain binds to GalNAc and contributes to the glycopeptide specificity By similarity.

Sequence similarities

Belongs to the glycosyltransferase 2 family. GalNAc-T subfamily.

Contains 1 ricin B-type lectin domain.

Sequence caution

The sequence BAB14795.1 differs from that shown. Reason: Chimeric at the C-terminus.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96FL9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: Major isoform.
Isoform 2 (identifier: Q96FL9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     100-132: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q96FL9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     44-99: PSDADWDDLW...NRAIPDTRHL → VWSLFFKVAG...HLQTQVFLQV
Note: Minor isoform.
Isoform 4 (identifier: Q96FL9-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRRLTRRLVLPVFGVLWITVLLFFWVTKRKLEVPTGPEVQTPK → MSFPMSLARSSVPFADSGLSSSQ

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 552552Polypeptide N-acetylgalactosaminyltransferase 14
PRO_0000059133

Regions

Topological domain1 – 66Cytoplasmic Potential
Transmembrane7 – 2620Helical; Signal-anchor for type II membrane protein; Potential
Topological domain27 – 552526Lumenal Potential
Domain415 – 550136Ricin B-type lectin
Region110 – 215106Catalytic subdomain A
Region274 – 33663Catalytic subdomain B

Sites

Metal binding1991Manganese By similarity
Metal binding2011Manganese By similarity
Metal binding3331Manganese By similarity
Binding site1511Substrate By similarity
Binding site1761Substrate By similarity
Binding site2001Substrate By similarity
Binding site3051Substrate By similarity
Binding site3361Substrate By similarity
Binding site3391Substrate By similarity
Binding site3411Substrate By similarity

Amino acid modifications

Disulfide bond101 ↔ 328 By similarity
Disulfide bond319 ↔ 397 By similarity
Disulfide bond430 ↔ 449 By similarity
Disulfide bond476 ↔ 493 By similarity
Disulfide bond517 ↔ 538 By similarity

Natural variations

Alternative sequence1 – 4343MRRLT…VQTPK → MSFPMSLARSSVPFADSGLS SSQ in isoform 4.
VSP_045121
Alternative sequence44 – 9956PSDAD…DTRHL → VWSLFFKVAGMSPWAPQVPV SPTPPYQRGHLPTGGHLAVC HFPCLLQEAQFHLQTQVFLQ V in isoform 3.
VSP_011221
Alternative sequence100 – 13233Missing in isoform 2.
VSP_011222
Natural variant4691Q → K.
Corresponds to variant rs2288101 [ dbSNP | Ensembl ].
VAR_033948

Experimental info

Sequence conflict3681Q → R in BAB14795. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: 6F2ABAA89F482696

FASTA55264,321
        10         20         30         40         50         60 
MRRLTRRLVL PVFGVLWITV LLFFWVTKRK LEVPTGPEVQ TPKPSDADWD DLWDQFDERR 

        70         80         90        100        110        120 
YLNAKKWRVG DDPYKLYAFN QRESERISSN RAIPDTRHLR CTLLVYCTDL PPTSIIITFH 

       130        140        150        160        170        180 
NEARSTLLRT IRSVLNRTPT HLIREIILVD DFSNDPDDCK QLIKLPKVKC LRNNERQGLV 

       190        200        210        220        230        240 
RSRIRGADIA QGTTLTFLDS HCEVNRDWLQ PLLHRVKEDY TRVVCPVIDI INLDTFTYIE 

       250        260        270        280        290        300 
SASELRGGFD WSLHFQWEQL SPEQKARRLD PTEPIRTPII AGGLFVIDKA WFDYLGKYDM 

       310        320        330        340        350        360 
DMDIWGGENF EISFRVWMCG GSLEIVPCSR VGHVFRKKHP YVFPDGNANT YIKNTKRTAE 

       370        380        390        400        410        420 
VWMDEYKQYY YAARPFALER PFGNVESRLD LRKNLRCQSF KWYLENIYPE LSIPKESSIQ 

       430        440        450        460        470        480 
KGNIRQRQKC LESQRQNNQE TPNLKLSPCA KVKGEDAKSQ VWAFTYTQQI LQEELCLSVI 

       490        500        510        520        530        540 
TLFPGAPVVL VLCKNGDDRQ QWTKTGSHIE HIASHLCLDT DMFGDGTENG KEIVVNPCES 

       550 
SLMSQHWDMV SS 

« Hide

Isoform 2 [UniParc].

Checksum: 9028631165BC7C08
Show »

FASTA51960,520
Isoform 3 [UniParc].

Checksum: 6968DC02A2AAF2F4
Show »

FASTA55764,289
Isoform 4 [UniParc].

Checksum: 685DB05D5597341F
Show »

FASTA53261,588

References

« Hide 'large scale' references
[1]"Cloning and characterization of a novel UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase, pp-GalNAc-T14."
Wang H., Tachibana K., Zhang Y., Iwasaki H., Kameyama A., Chen L., Guo J.-M., Hiruma T., Togayachi A., Kudo T., Kikuchi N., Narimatsu H.
Biochem. Biophys. Res. Commun. 300:738-744(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), ENZYME ACTIVITY, ALTERNATIVE SPLICING, TISSUE SPECIFICITY.
Tissue: Stomach.
[2]Wandall H.H., Bennett E.P.
Submitted (SEP-2011) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 3 AND 4), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-435 (ISOFORM 2).
Tissue: Fibroblast, Retinoblastoma and Teratocarcinoma.
[5]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Eye and Ovary.
[8]"Development of immunohistochemistry assays to assess GALNT14 and FUT3/6 in clinical trials of dulanermin and drozitumab."
Stern H.M., Padilla M., Wagner K., Amler L., Ashkenazi A.
Clin. Cancer Res. 16:1587-1596(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: TISSUE SPECIFICITY.
+Additional computationally mapped references.

Web resources

GGDB

GlycoGene database

Functional Glycomics Gateway - GTase

Polypeptide N-acetylgalactosaminyltransferase 14

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB078144 mRNA. Translation: BAC56889.1.
Y09324 mRNA. Translation: CAA70505.4.
AY358758 mRNA. Translation: AAQ89118.1.
AK022753 mRNA. Translation: BAB14227.1.
AK024039 mRNA. Translation: BAB14795.1. Sequence problems.
AK091313 mRNA. Translation: BAC03634.1.
AK122747 mRNA. Translation: BAG53701.1.
AC009301 Genomic DNA. Translation: AAX88899.1.
AC009305 Genomic DNA. Translation: AAX93209.1.
AC015980 Genomic DNA. Translation: AAY24301.1.
CH471053 Genomic DNA. Translation: EAX00489.1.
BC006269 mRNA. Translation: AAH06269.2.
BC010659 mRNA. Translation: AAH10659.1.
CCDSCCDS1773.2. [Q96FL9-1]
CCDS58705.1. [Q96FL9-4]
CCDS58706.1. [Q96FL9-3]
RefSeqNP_001240755.1. NM_001253826.1. [Q96FL9-3]
NP_001240756.1. NM_001253827.1. [Q96FL9-4]
NP_078848.2. NM_024572.3. [Q96FL9-1]
UniGeneHs.468058.

3D structure databases

ProteinModelPortalQ96FL9.
SMRQ96FL9. Positions 78-547.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122753. 4 interactions.
STRING9606.ENSP00000288988.

Protein family/group databases

CAZyCBM13. Carbohydrate-Binding Module Family 13.
GT27. Glycosyltransferase Family 27.

PTM databases

PhosphoSiteQ96FL9.

Polymorphism databases

DMDM51316071.

Proteomic databases

MaxQBQ96FL9.
PaxDbQ96FL9.
PRIDEQ96FL9.

Protocols and materials databases

DNASU79623.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000324589; ENSP00000314500; ENSG00000158089. [Q96FL9-3]
ENST00000349752; ENSP00000288988; ENSG00000158089. [Q96FL9-1]
ENST00000356174; ENSP00000348497; ENSG00000158089. [Q96FL9-2]
ENST00000406653; ENSP00000385435; ENSG00000158089. [Q96FL9-4]
GeneID79623.
KEGGhsa:79623.
UCSCuc002rnq.3. human.
uc002rnr.3. human. [Q96FL9-1]
uc002rns.3. human. [Q96FL9-3]
uc010ezo.2. human. [Q96FL9-2]

Organism-specific databases

CTD79623.
GeneCardsGC02M031044.
HGNCHGNC:22946. GALNT14.
HPAHPA010785.
MIM608225. gene.
neXtProtNX_Q96FL9.
PharmGKBPA134920089.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG239675.
HOVERGENHBG051699.
KOK00710.
OMAHEPEATN.
OrthoDBEOG7J9VP2.
PhylomeDBQ96FL9.
TreeFamTF313267.

Enzyme and pathway databases

ReactomeREACT_17015. Metabolism of proteins.
UniPathwayUPA00378.

Gene expression databases

ArrayExpressQ96FL9.
BgeeQ96FL9.
CleanExHS_GALNT14.
GenevestigatorQ96FL9.

Family and domain databases

Gene3D3.90.550.10. 1 hit.
InterProIPR027791. Galactosyl_T_C.
IPR001173. Glyco_trans_2-like.
IPR029044. Nucleotide-diphossugar_trans.
IPR000772. Ricin_B_lectin.
[Graphical view]
PfamPF02709. Glyco_transf_7C. 1 hit.
PF00535. Glycos_transf_2. 1 hit.
PF00652. Ricin_B_lectin. 1 hit.
[Graphical view]
SMARTSM00458. RICIN. 1 hit.
[Graphical view]
SUPFAMSSF50370. SSF50370. 1 hit.
SSF53448. SSF53448. 1 hit.
PROSITEPS50231. RICIN_B_LECTIN. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSGALNT14. human.
GeneWikiGALNT14.
GenomeRNAi79623.
NextBio68697.
PROQ96FL9.
SOURCESearch...

Entry information

Entry nameGLT14_HUMAN
AccessionPrimary (citable) accession number: Q96FL9
Secondary accession number(s): B3KV89 expand/collapse secondary AC list , Q4ZG75, Q53SU1, Q53TJ0, Q8IVI4, Q9BRH1, Q9H827, Q9H9J8
Entry history
Integrated into UniProtKB/Swiss-Prot: August 16, 2004
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM