Reviewed,
UniProtKB/Swiss-Prot Q96FJ0 (STALP_HUMAN)
Last modified
November 3, 2009.
Version 59.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: AMSH-like protease Short name=AMSH-LP EC=3.1.2.15 Alternative name(s): STAM-binding protein-like 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 436 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains. Ref.6 |
| Catalytic activity | Ubiquitin C-terminal thioester + H2O = ubiquitin + a thiol. |
| Cofactor | Binds 2 zinc ions per subunit. Ref.6 |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Domain | The JAMM motif is essential for the protease activity By similarity. |
| Sequence similarities | Belongs to the peptidase M67C family. Contains 1 MPN (JAB/Mov34) domain. |
| Sequence caution | The sequence CAI13863.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | modification-dependent protein catabolic process Inferred from electronic annotation. Source: UniProtKB-KW |
| Molecular function | metallopeptidase activity Inferred from electronic annotation. Source: UniProtKB-KW ubiquitin thiolesterase activityInferred from electronic annotation. Source: EC zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96FJ0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96FJ0-2) The sequence of this isoform differs from the canonical sequence as follows: 420-436: CKHVLVKDIKIIVLDLR → QKFLSGIISGTALEMEPLKIGYGPNGFPLLGISRSSSPSEQL |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 436 | 436 | AMSH-like protease | PRO_0000194874 | ||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||
| Domain | 264 – 373 | 110 | MPN | |||||||||||||||||||||||||||||||||||
| Motif | 347 – 360 | 14 | JAMM motif | |||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||
| Metal binding | 347 | 1 | Zinc 1; catalytic | |||||||||||||||||||||||||||||||||||
| Metal binding | 349 | 1 | Zinc 1; catalytic | |||||||||||||||||||||||||||||||||||
| Metal binding | 360 | 1 | Zinc 1; catalytic | |||||||||||||||||||||||||||||||||||
| Metal binding | 362 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||
| Metal binding | 402 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||
| Metal binding | 408 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||
| Metal binding | 410 | 1 | Zinc 2 | |||||||||||||||||||||||||||||||||||
| Site | 292 | 1 | Indirect Zinc-binding | |||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||
| Modified residue | 25 | 1 | Phosphoserine Ref.5 | |||||||||||||||||||||||||||||||||||
| Modified residue | 242 | 1 | Phosphoserine Ref.5 | |||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 420 – 436 | 17 | CKHVL…VLDLR → QKFLSGIISGTALEMEPLKI GYGPNGFPLLGISRSSSPSE QL in isoform 2. | VSP_014648 | ||||||||||||||||||||||||||||||||||
| Natural variant | 196 | 1 | S → N: dbSNP rs12254856. | VAR_051817 | ||||||||||||||||||||||||||||||||||
| Natural variant | 204 | 1 | E → K: dbSNP rs34270879. | VAR_051818 | ||||||||||||||||||||||||||||||||||
| Natural variant | 210 | 1 | A → T: dbSNP rs9988723. | VAR_051819 | ||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 292 | 1 | E → A: Complete loss of catalytic activity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 329 | 1 | E → A: 3-fold decrease in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 332 | 1 | F → A: 12-fold decrease in substrate affinity, little effect on catalytic activity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 353 | 1 | T → A: 19-fold decrease in activity, no change in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 355 | 1 | F → A: 161-fold decrease in activity, no change in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 357 | 1 | S → A: 34-fold decrease in activity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 358 | 1 | S → A: 10-fold decrease in activity, no change in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 360 | 1 | D → A: Complete loss of catalytic activity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 370 | 1 | M → A: 18-fold decrease in substrate affinity, little effect on catalytic activity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 402 | 1 | C → S: 402-fold decrease in activity, slight increase in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
| Mutagenesis | 407 | 1 | F → A: 35-fold decrease in activity, slight increase in substrate affinity. Ref.6 | |||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||
| Beta strand | 269 – 272 | 4 | ||||||||||||||||||||||||||||||||||||
| Helix | 275 – 287 | 13 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 300 – 302 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 305 – 313 | 9 | ||||||||||||||||||||||||||||||||||||
| Helix | 328 – 338 | 11 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 346 – 348 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 350 – 352 | 3 | ||||||||||||||||||||||||||||||||||||
| Helix | 358 – 370 | 13 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 376 – 380 | 5 | ||||||||||||||||||||||||||||||||||||
| Helix | 381 – 383 | 3 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 389 – 391 | 3 | ||||||||||||||||||||||||||||||||||||
| Helix | 397 – 401 | 5 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 416 – 419 | 4 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 421 – 426 | 6 | ||||||||||||||||||||||||||||||||||||
| Beta strand | 431 – 434 | 4 | ||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of AMSH-LP containing a Jab1/MPN domain metalloenzyme motif." Kikuchi K., Ishii N., Asano H., Sugamura K. Biochem. Biophys. Res. Commun. 306:637-643(2003) [PubMed: 12810066] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION. Tissue: Peripheral blood lymphocyte. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed: 10718198] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
| [5] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-25 AND SER-242, MASS SPECTROMETRY. |
| [6] | "Structural basis for specific cleavage of Lys 63-linked polyubiquitin chains." Sato Y., Yoshikawa A., Yamagata A., Mimura H., Yamashita M., Ookata K., Nureki O., Iwai K., Komada M., Fukai S. Nature 455:358-362(2008) [PubMed: 18758443] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.2 ANGSTROMS) OF 263-436 IN COMPLEXES WITH ZINC IONS AND WITH LYS-63-LINKED DI-UBIQUITIN, FUNCTION, COFACTOR, MUTAGENESIS OF GLU-292; GLU-329; PHE-332; THR-353; PHE-355; SER-357; SER-358; ASP-360; MET-370; CYS-402 AND PHE-407. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AB010120 mRNA. Translation: BAC77766.1. AB037794 mRNA. Translation: BAA92611.1. Different initiation. AL157394 Genomic DNA. Translation: CAI13861.1. AL157394 Genomic DNA. Translation: CAI13862.1. AL157394 Genomic DNA. Translation: CAI13863.1. Sequence problems. BC010846 mRNA. Translation: AAH10846.2. | |||||||||||||||||||
| IPI | IPI00002208. IPI00290975. | ||||||||||||||||||
| RefSeq | NP_065850.1. | ||||||||||||||||||
| UniGene | Hs.16229 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q96FJ0. 1 interaction. | ||||||||||||||||||
| STRING | Q96FJ0. | ||||||||||||||||||
Protein family/group databases | |||||||||||||||||||
| MEROPS | M67.003. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q96FJ0. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q96FJ0. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000371922; ENSP00000360990; ENSG00000138134; Homo sapiens. [Genome view] ENST00000371924; ENSP00000360992; ENSG00000138134; Homo sapiens. [Genome view] ENST00000371926; ENSP00000360994; ENSG00000138134; Homo sapiens. [Genome view] ENST00000371927; ENSP00000360995; ENSG00000138134; Homo sapiens. [Genome view] | ||||||||||||||||||
| GeneID | 57559. | ||||||||||||||||||
| KEGG | hsa:57559. | ||||||||||||||||||
| UCSC | uc001kfk.1. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 57559. | ||||||||||||||||||
| GeneCards | GC10P090630. | ||||||||||||||||||
| H-InvDB | HIX0009014. | ||||||||||||||||||
| HGNC | HGNC:24105. STAMBPL1. | ||||||||||||||||||
| MIM | 612352. gene. | ||||||||||||||||||
| PharmGKB | PA142670864. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOVERGEN | Q96FJ0. | ||||||||||||||||||
| OMA | FTVNSLK. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| BRENDA | 3.1.2.15. 247. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q96FJ0. | ||||||||||||||||||
| Bgee | Q96FJ0. | ||||||||||||||||||
| CleanEx | HS_STAMBPL1. | ||||||||||||||||||
| Genevestigator | Q96FJ0. | ||||||||||||||||||
| GermOnline | ENSG00000138134. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000555. Mov34_MPN_PAD1. [Graphical view] | ||||||||||||||||||
| Pfam | PF01398. Mov34. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00232. JAB_MPN. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 64054. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | STALP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96FJ0 Secondary accession number(s): Q5T9N4 Q9P2H4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| Peptidase families Classification of peptidase families and list of entries |
| SIMILARITY comments Index of protein domains and families |

Clusters with


