Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

AMSH-like protease

Gene

STAMBPL1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Zinc metalloprotease that specifically cleaves 'Lys-63'-linked polyubiquitin chains. Does not cleave 'Lys-48'-linked polyubiquitin chains.1 Publication

Cofactori

Zn2+1 PublicationNote: Binds 2 Zn2+ ions per subunit.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei292Indirect zinc-binding1
Metal bindingi347Zinc 1; catalytic1
Metal bindingi349Zinc 1; catalytic1
Metal bindingi360Zinc 1; catalytic1
Metal bindingi362Zinc 21
Metal bindingi402Zinc 21
Metal bindingi408Zinc 21
Metal bindingi410Zinc 21

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Metalloprotease, Protease

Keywords - Biological processi

Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:HS13713-MONOMER.
ReactomeiR-HSA-5689901. Metalloprotease DUBs.

Protein family/group databases

MEROPSiM67.003.

Names & Taxonomyi

Protein namesi
Recommended name:
AMSH-like protease (EC:3.4.19.-)
Short name:
AMSH-LP
Alternative name(s):
STAM-binding protein-like 1
Gene namesi
Name:STAMBPL1
Synonyms:AMSHLP, KIAA1373
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:24105. STAMBPL1.

Subcellular locationi

GO - Cellular componenti

  • membrane Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi292E → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi329E → A: 3-fold decrease in substrate affinity. 1 Publication1
Mutagenesisi332F → A: 12-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi353T → A: 19-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi355F → A: 161-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi357S → A: 34-fold decrease in activity. 1 Publication1
Mutagenesisi358S → A: 10-fold decrease in activity, no change in substrate affinity. 1 Publication1
Mutagenesisi360D → A: Complete loss of catalytic activity. 1 Publication1
Mutagenesisi370M → A: 18-fold decrease in substrate affinity, little effect on catalytic activity. 1 Publication1
Mutagenesisi402C → S: 402-fold decrease in activity, slight increase in substrate affinity. 1 Publication1
Mutagenesisi407F → A: 35-fold decrease in activity, slight increase in substrate affinity. 1 Publication1

Organism-specific databases

DisGeNETi57559.
OpenTargetsiENSG00000138134.
PharmGKBiPA142670864.

Polymorphism and mutation databases

BioMutaiSTAMBPL1.
DMDMi71153542.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001948741 – 436AMSH-like proteaseAdd BLAST436

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei25PhosphoserineCombined sources1
Modified residuei242PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96FJ0.
MaxQBiQ96FJ0.
PaxDbiQ96FJ0.
PeptideAtlasiQ96FJ0.
PRIDEiQ96FJ0.

PTM databases

iPTMnetiQ96FJ0.
PhosphoSitePlusiQ96FJ0.

Expressioni

Tissue specificityi

Ubiquitously expressed.1 Publication

Gene expression databases

BgeeiENSG00000138134.
CleanExiHS_STAMBPL1.
ExpressionAtlasiQ96FJ0. baseline and differential.
GenevisibleiQ96FJ0. HS.

Organism-specific databases

HPAiHPA040202.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CEP72Q9P2097EBI-745021,EBI-739498
GNPTABQ3T9063EBI-745021,EBI-1104907
GOLGA2Q083793EBI-745021,EBI-618309
IKZF3Q9UKT93EBI-745021,EBI-747204
INCA1Q0VD863EBI-745021,EBI-6509505
LAX1Q8IWV13EBI-745021,EBI-10232942
MAGEA6P433605EBI-745021,EBI-1045155
PNMA1Q8ND903EBI-745021,EBI-302345
RAB2AP610196EBI-745021,EBI-752037
RNF32Q9H0A62EBI-745021,EBI-724829
TCF4P158843EBI-745021,EBI-533224
TRIM27P143733EBI-745021,EBI-719493

Protein-protein interaction databases

BioGridi121614. 48 interactors.
IntActiQ96FJ0. 35 interactors.
MINTiMINT-1444179.
STRINGi9606.ENSP00000360992.

Structurei

Secondary structure

1436
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi269 – 272Combined sources4
Helixi275 – 287Combined sources13
Turni288 – 290Combined sources3
Beta strandi294 – 302Combined sources9
Beta strandi305 – 313Combined sources9
Beta strandi316 – 319Combined sources4
Beta strandi322 – 325Combined sources4
Helixi328 – 338Combined sources11
Beta strandi341 – 348Combined sources8
Beta strandi350 – 352Combined sources3
Helixi358 – 370Combined sources13
Beta strandi375 – 380Combined sources6
Helixi381 – 383Combined sources3
Beta strandi385 – 391Combined sources7
Helixi393 – 401Combined sources9
Beta strandi416 – 419Combined sources4
Beta strandi421 – 426Combined sources6
Beta strandi431 – 434Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ZNRX-ray1.20A264-436[»]
2ZNVX-ray1.60A/D264-436[»]
ProteinModelPortaliQ96FJ0.
SMRiQ96FJ0.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96FJ0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini264 – 373MPNAdd BLAST110

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi347 – 360JAMM motifAdd BLAST14

Domaini

The JAMM motif is essential for the protease activity.By similarity

Sequence similaritiesi

Belongs to the peptidase M67C family.Curated
Contains 1 MPN (JAB/Mov34) domain.Curated

Phylogenomic databases

eggNOGiKOG2880. Eukaryota.
COG1310. LUCA.
GeneTreeiENSGT00390000015439.
HOGENOMiHOG000195792.
HOVERGENiHBG058519.
InParanoidiQ96FJ0.
KOiK11867.
OMAiPDYCDME.
OrthoDBiEOG091G06CJ.
PhylomeDBiQ96FJ0.
TreeFamiTF323215.

Family and domain databases

InterProiIPR000555. JAMM/MPN+_dom.
IPR015063. USP8_dimer.
[Graphical view]
PfamiPF01398. JAB. 1 hit.
PF08969. USP8_dimer. 1 hit.
[Graphical view]
SMARTiSM00232. JAB_MPN. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FJ0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDQPFTVNSL KKLAAMPDHT DVSLSPEERV RALSKLGCNI TISEDITPRR
60 70 80 90 100
YFRSGVEMER MASVYLEEGN LENAFVLYNK FITLFVEKLP NHRDYQQCAV
110 120 130 140 150
PEKQDIMKKL KEIAFPRTDE LKNDLLKKYN VEYQEYLQSK NKYKAEILKK
160 170 180 190 200
LEHQRLIEAE RKRIAQMRQQ QLESEQFLFF EDQLKKQELA RGQMRSQQTS
210 220 230 240 250
GLSEQIDGSA LSCFSTHQNN SLLNVFADQP NKSDATNYAS HSPPVNRALT
260 270 280 290 300
PAATLSAVQN LVVEGLRCVV LPEDLCHKFL QLAESNTVRG IETCGILCGK
310 320 330 340 350
LTHNEFTITH VIVPKQSAGP DYCDMENVEE LFNVQDQHDL LTLGWIHTHP
360 370 380 390 400
TQTAFLSSVD LHTHCSYQLM LPEAIAIVCS PKHKDTGIFR LTNAGMLEVS
410 420 430
ACKKKGFHPH TKEPRLFSIC KHVLVKDIKI IVLDLR
Length:436
Mass (Da):49,783
Last modified:November 23, 2004 - v2
Checksum:i722662C76A734102
GO
Isoform 2 (identifier: Q96FJ0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     420-436: CKHVLVKDIKIIVLDLR → QKFLSGIISGTALEMEPLKIGYGPNGFPLLGISRSSSPSEQL

Show »
Length:461
Mass (Da):52,199
Checksum:i266828EB12055970
GO

Sequence cautioni

The sequence BAA92611 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI13863 differs from that shown. Reason: Erroneous gene model prediction.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051817196S → N.Corresponds to variant rs12254856dbSNPEnsembl.1
Natural variantiVAR_051818204E → K.Corresponds to variant rs34270879dbSNPEnsembl.1
Natural variantiVAR_051819210A → T.Corresponds to variant rs9988723dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_014648420 – 436CKHVL…VLDLR → QKFLSGIISGTALEMEPLKI GYGPNGFPLLGISRSSSPSE QL in isoform 2. 1 PublicationAdd BLAST17

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB010120 mRNA. Translation: BAC77766.1.
AB037794 mRNA. Translation: BAA92611.1. Different initiation.
AK056086 mRNA. Translation: BAG51619.1.
AL157394 Genomic DNA. Translation: CAI13861.1.
AL157394 Genomic DNA. Translation: CAI13862.1.
AL157394 Genomic DNA. Translation: CAI13863.1. Sequence problems.
CH471066 Genomic DNA. Translation: EAW50156.1.
BC010846 mRNA. Translation: AAH10846.2.
CCDSiCCDS7391.1. [Q96FJ0-1]
RefSeqiNP_065850.1. NM_020799.3. [Q96FJ0-1]
XP_006717991.1. XM_006717928.2. [Q96FJ0-1]
XP_006717993.1. XM_006717930.3. [Q96FJ0-1]
XP_011538285.1. XM_011539983.1. [Q96FJ0-1]
XP_011538287.1. XM_011539985.1. [Q96FJ0-1]
XP_016871942.1. XM_017016453.1. [Q96FJ0-1]
XP_016871943.1. XM_017016454.1. [Q96FJ0-1]
XP_016871944.1. XM_017016455.1. [Q96FJ0-1]
XP_016871945.1. XM_017016456.1. [Q96FJ0-1]
UniGeneiHs.16229.
Hs.701879.

Genome annotation databases

EnsembliENST00000371924; ENSP00000360992; ENSG00000138134. [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134. [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134. [Q96FJ0-2]
GeneIDi57559.
KEGGihsa:57559.
UCSCiuc001kfk.5. human. [Q96FJ0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB010120 mRNA. Translation: BAC77766.1.
AB037794 mRNA. Translation: BAA92611.1. Different initiation.
AK056086 mRNA. Translation: BAG51619.1.
AL157394 Genomic DNA. Translation: CAI13861.1.
AL157394 Genomic DNA. Translation: CAI13862.1.
AL157394 Genomic DNA. Translation: CAI13863.1. Sequence problems.
CH471066 Genomic DNA. Translation: EAW50156.1.
BC010846 mRNA. Translation: AAH10846.2.
CCDSiCCDS7391.1. [Q96FJ0-1]
RefSeqiNP_065850.1. NM_020799.3. [Q96FJ0-1]
XP_006717991.1. XM_006717928.2. [Q96FJ0-1]
XP_006717993.1. XM_006717930.3. [Q96FJ0-1]
XP_011538285.1. XM_011539983.1. [Q96FJ0-1]
XP_011538287.1. XM_011539985.1. [Q96FJ0-1]
XP_016871942.1. XM_017016453.1. [Q96FJ0-1]
XP_016871943.1. XM_017016454.1. [Q96FJ0-1]
XP_016871944.1. XM_017016455.1. [Q96FJ0-1]
XP_016871945.1. XM_017016456.1. [Q96FJ0-1]
UniGeneiHs.16229.
Hs.701879.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2ZNRX-ray1.20A264-436[»]
2ZNVX-ray1.60A/D264-436[»]
ProteinModelPortaliQ96FJ0.
SMRiQ96FJ0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121614. 48 interactors.
IntActiQ96FJ0. 35 interactors.
MINTiMINT-1444179.
STRINGi9606.ENSP00000360992.

Protein family/group databases

MEROPSiM67.003.

PTM databases

iPTMnetiQ96FJ0.
PhosphoSitePlusiQ96FJ0.

Polymorphism and mutation databases

BioMutaiSTAMBPL1.
DMDMi71153542.

Proteomic databases

EPDiQ96FJ0.
MaxQBiQ96FJ0.
PaxDbiQ96FJ0.
PeptideAtlasiQ96FJ0.
PRIDEiQ96FJ0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000371924; ENSP00000360992; ENSG00000138134. [Q96FJ0-1]
ENST00000371926; ENSP00000360994; ENSG00000138134. [Q96FJ0-1]
ENST00000371927; ENSP00000360995; ENSG00000138134. [Q96FJ0-2]
GeneIDi57559.
KEGGihsa:57559.
UCSCiuc001kfk.5. human. [Q96FJ0-1]

Organism-specific databases

CTDi57559.
DisGeNETi57559.
GeneCardsiSTAMBPL1.
H-InvDBHIX0009014.
HGNCiHGNC:24105. STAMBPL1.
HPAiHPA040202.
MIMi612352. gene.
neXtProtiNX_Q96FJ0.
OpenTargetsiENSG00000138134.
PharmGKBiPA142670864.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2880. Eukaryota.
COG1310. LUCA.
GeneTreeiENSGT00390000015439.
HOGENOMiHOG000195792.
HOVERGENiHBG058519.
InParanoidiQ96FJ0.
KOiK11867.
OMAiPDYCDME.
OrthoDBiEOG091G06CJ.
PhylomeDBiQ96FJ0.
TreeFamiTF323215.

Enzyme and pathway databases

BioCyciZFISH:HS13713-MONOMER.
ReactomeiR-HSA-5689901. Metalloprotease DUBs.

Miscellaneous databases

ChiTaRSiSTAMBPL1. human.
EvolutionaryTraceiQ96FJ0.
GeneWikiiSTAMBPL1.
GenomeRNAii57559.
PROiQ96FJ0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000138134.
CleanExiHS_STAMBPL1.
ExpressionAtlasiQ96FJ0. baseline and differential.
GenevisibleiQ96FJ0. HS.

Family and domain databases

InterProiIPR000555. JAMM/MPN+_dom.
IPR015063. USP8_dimer.
[Graphical view]
PfamiPF01398. JAB. 1 hit.
PF08969. USP8_dimer. 1 hit.
[Graphical view]
SMARTiSM00232. JAB_MPN. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSTALP_HUMAN
AccessioniPrimary (citable) accession number: Q96FJ0
Secondary accession number(s): B3KPA7
, Q5T9N4, Q5T9N9, Q7Z420, Q9P2H4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: November 23, 2004
Last modified: November 30, 2016
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Peptidase families
    Classification of peptidase families and list of entries
  7. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.