Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Phytanoyl-CoA hydroxylase-interacting protein-like

Gene

PHYHIPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May play a role in the development of the central system.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Phytanoyl-CoA hydroxylase-interacting protein-like
Gene namesi
Name:PHYHIPL
Synonyms:KIAA1796
ORF Names:UNQ6309/PRO20934
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:29378. PHYHIPL.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134906827.

Polymorphism and mutation databases

BioMutaiPHYHIPL.
DMDMi296439274.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 376376Phytanoyl-CoA hydroxylase-interacting protein-likePRO_0000338641Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei12 – 121PhosphoserineBy similarity
Modified residuei15 – 151PhosphoserineBy similarity
Glycosylationi23 – 231N-linked (GlcNAc...)Sequence analysis
Modified residuei25 – 251PhosphoserineBy similarity
Glycosylationi37 – 371N-linked (GlcNAc...)Sequence analysis

Keywords - PTMi

Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96FC7.
PaxDbiQ96FC7.
PeptideAtlasiQ96FC7.
PRIDEiQ96FC7.

PTM databases

iPTMnetiQ96FC7.
PhosphoSiteiQ96FC7.

Expressioni

Gene expression databases

BgeeiQ96FC7.
CleanExiHS_PHYHIPL.
GenevisibleiQ96FC7. HS.

Organism-specific databases

HPAiHPA038746.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PDE9AO760833EBI-10285660,EBI-742764

Protein-protein interaction databases

BioGridi124092. 4 interactions.
IntActiQ96FC7. 2 interactions.
MINTiMINT-1444917.
STRINGi9606.ENSP00000362987.

Structurei

3D structure databases

ProteinModelPortaliQ96FC7.
SMRiQ96FC7. Positions 51-160.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini52 – 161110Fibronectin type-IIIPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Belongs to the PHYHIP family.Curated
Contains 1 fibronectin type-III domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiENOG410IEM3. Eukaryota.
ENOG410Y0U7. LUCA.
GeneTreeiENSGT00390000014563.
HOVERGENiHBG053596.
InParanoidiQ96FC7.
OMAiLVFHHAQ.
OrthoDBiEOG7CK372.
PhylomeDBiQ96FC7.
TreeFamiTF314485.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF00041. fn3. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96FC7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVPRLDHAL NSPTSPCEEV IKNLSLEAIQ LCDRDGNKSQ DSGIAEMEEL
60 70 80 90 100
PVPHNIKISN ITCDSFKISW EMDSKSKDRI THYFIDLNKK ENKNSNKFKH
110 120 130 140 150
KDVPTKLVAK AVPLPMTVRG HWFLSPRTEY TVAVQTASKQ VDGDYVVSEW
160 170 180 190 200
SEIIEFCTAD YSKVHLTQLL EKAEVIAGRM LKFSVFYRNQ HKEYFDYVRE
210 220 230 240 250
HHGNAMQPSV KDNSGSHGSP ISGKLEGIFF SCSTEFNTGK PPQDSPYGRY
260 270 280 290 300
RFEIAAEKLF NPNTNLYFGD FYCMYTAYHY VILVIAPVGS PGDEFCKQRL
310 320 330 340 350
PQLNSKDNKF LTCTEEDGVL VYHHAQDVIL EVIYTDPVDL SVGTVAEITG
360 370
HQLMSLSTAN AKKDPSCKTC NISVGR
Length:376
Mass (Da):42,486
Last modified:May 18, 2010 - v3
Checksum:i82B811267DFF088C
GO
Isoform 2 (identifier: Q96FC7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MEVPRLDHALNSPTSPCEEVIKNLSLEAIQLCDRDG → MCCDSDFVAR

Show »
Length:350
Mass (Da):39,638
Checksum:i8ED6065B4AB4CDE8
GO
Isoform 3 (identifier: Q96FC7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     36-49: GNKSQDSGIAEMEE → VVFEELTSKQTRKG
     50-376: Missing.

Show »
Length:49
Mass (Da):5,541
Checksum:iF45A14AF238B8B05
GO

Sequence cautioni

The sequence AAQ88529.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence CAB97028.1 differs from that shown. Reason: Frameshift at position 350. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti342 – 3421V → L.7 Publications
Corresponds to variant rs2452505 [ dbSNP | Ensembl ].
VAR_043817

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3636MEVPR…CDRDG → MCCDSDFVAR in isoform 2. 1 PublicationVSP_034067Add
BLAST
Alternative sequencei36 – 4914GNKSQ…AEMEE → VVFEELTSKQTRKG in isoform 3. 1 PublicationVSP_034068Add
BLAST
Alternative sequencei50 – 376327Missing in isoform 3. 1 PublicationVSP_034069Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL365474 mRNA. Translation: CAB97028.1. Frameshift.
AK054956 mRNA. Translation: BAB70832.1.
AL834339 mRNA. Translation: CAD39006.1.
CR749429 mRNA. Translation: CAH18267.1.
AC016398 Genomic DNA. No translation available.
AC025038 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54185.1.
BC011268 mRNA. Translation: AAH11268.2.
AY358162 mRNA. Translation: AAQ88529.1. Different initiation.
AB058699 mRNA. Translation: BAB47425.1.
CCDSiCCDS44405.1. [Q96FC7-2]
CCDS7254.1. [Q96FC7-1]
RefSeqiNP_001137246.1. NM_001143774.1. [Q96FC7-2]
NP_115815.2. NM_032439.3. [Q96FC7-1]
UniGeneiHs.499704.

Genome annotation databases

EnsembliENST00000373878; ENSP00000362985; ENSG00000165443. [Q96FC7-2]
ENST00000373880; ENSP00000362987; ENSG00000165443. [Q96FC7-1]
ENST00000486074; ENSP00000423634; ENSG00000165443. [Q96FC7-3]
GeneIDi84457.
KEGGihsa:84457.
UCSCiuc001jkk.5. human. [Q96FC7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL365474 mRNA. Translation: CAB97028.1. Frameshift.
AK054956 mRNA. Translation: BAB70832.1.
AL834339 mRNA. Translation: CAD39006.1.
CR749429 mRNA. Translation: CAH18267.1.
AC016398 Genomic DNA. No translation available.
AC025038 Genomic DNA. No translation available.
CH471083 Genomic DNA. Translation: EAW54185.1.
BC011268 mRNA. Translation: AAH11268.2.
AY358162 mRNA. Translation: AAQ88529.1. Different initiation.
AB058699 mRNA. Translation: BAB47425.1.
CCDSiCCDS44405.1. [Q96FC7-2]
CCDS7254.1. [Q96FC7-1]
RefSeqiNP_001137246.1. NM_001143774.1. [Q96FC7-2]
NP_115815.2. NM_032439.3. [Q96FC7-1]
UniGeneiHs.499704.

3D structure databases

ProteinModelPortaliQ96FC7.
SMRiQ96FC7. Positions 51-160.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124092. 4 interactions.
IntActiQ96FC7. 2 interactions.
MINTiMINT-1444917.
STRINGi9606.ENSP00000362987.

PTM databases

iPTMnetiQ96FC7.
PhosphoSiteiQ96FC7.

Polymorphism and mutation databases

BioMutaiPHYHIPL.
DMDMi296439274.

Proteomic databases

MaxQBiQ96FC7.
PaxDbiQ96FC7.
PeptideAtlasiQ96FC7.
PRIDEiQ96FC7.

Protocols and materials databases

DNASUi84457.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373878; ENSP00000362985; ENSG00000165443. [Q96FC7-2]
ENST00000373880; ENSP00000362987; ENSG00000165443. [Q96FC7-1]
ENST00000486074; ENSP00000423634; ENSG00000165443. [Q96FC7-3]
GeneIDi84457.
KEGGihsa:84457.
UCSCiuc001jkk.5. human. [Q96FC7-1]

Organism-specific databases

CTDi84457.
GeneCardsiPHYHIPL.
HGNCiHGNC:29378. PHYHIPL.
HPAiHPA038746.
neXtProtiNX_Q96FC7.
PharmGKBiPA134906827.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IEM3. Eukaryota.
ENOG410Y0U7. LUCA.
GeneTreeiENSGT00390000014563.
HOVERGENiHBG053596.
InParanoidiQ96FC7.
OMAiLVFHHAQ.
OrthoDBiEOG7CK372.
PhylomeDBiQ96FC7.
TreeFamiTF314485.

Miscellaneous databases

ChiTaRSiPHYHIPL. human.
GeneWikiiPHYHIPL.
GenomeRNAii84457.
PROiQ96FC7.

Gene expression databases

BgeeiQ96FC7.
CleanExiHS_PHYHIPL.
GenevisibleiQ96FC7. HS.

Family and domain databases

Gene3Di2.60.40.10. 1 hit.
InterProiIPR003961. FN3_dom.
IPR013783. Ig-like_fold.
[Graphical view]
PfamiPF00041. fn3. 1 hit.
[Graphical view]
SUPFAMiSSF49265. SSF49265. 1 hit.
PROSITEiPS50853. FN3. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT LEU-342.
    Tissue: Amygdala.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-342.
    Tissue: Cerebellum.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT LEU-342.
    Tissue: Amygdala and Retina.
  4. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT LEU-342.
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT LEU-342.
    Tissue: Brain.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 36-376 (ISOFORM 1), VARIANT LEU-342.
  8. "Prediction of the coding sequences of unidentified human genes. XX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Nakayama M., Nakajima D., Kikuno R., Ohara O.
    DNA Res. 8:85-95(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 132-376 (ISOFORM 1), VARIANT LEU-342.
    Tissue: Brain.
  9. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  10. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiPHIPL_HUMAN
AccessioniPrimary (citable) accession number: Q96FC7
Secondary accession number(s): B7WP61
, Q68DF3, Q6UXY3, Q8N3W3, Q96JM9, Q96NP7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: June 10, 2008
Last sequence update: May 18, 2010
Last modified: July 6, 2016
This is version 124 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.