Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CB1 cannabinoid receptor-interacting protein 1

Gene

CNRIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Isoform 1 suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels. Isoform 2 does not have this effect.1 Publication

Names & Taxonomyi

Protein namesi
Recommended name:
CB1 cannabinoid receptor-interacting protein 1
Short name:
CRIP-1
Gene namesi
Name:CNRIP1
Synonyms:C2orf32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:24546. CNRIP1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162382635.

Polymorphism and mutation databases

BioMutaiCNRIP1.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 164164CB1 cannabinoid receptor-interacting protein 1PRO_0000089360Add
BLAST

Proteomic databases

EPDiQ96F85.
MaxQBiQ96F85.
PaxDbiQ96F85.
PeptideAtlasiQ96F85.
PRIDEiQ96F85.

2D gel databases

UCD-2DPAGEQ96F85.

PTM databases

iPTMnetiQ96F85.
PhosphoSiteiQ96F85.

Expressioni

Gene expression databases

BgeeiENSG00000119865.
CleanExiHS_CNRIP1.
ExpressionAtlasiQ96F85. baseline and differential.
GenevisibleiQ96F85. HS.

Organism-specific databases

HPAiHPA035337.

Interactioni

Subunit structurei

Interacts with the cannabinoid receptor CNR1 (via C-terminus). Does not interact with cannabinoid receptor CNR2.1 Publication

Protein-protein interaction databases

BioGridi117427. 9 interactions.
IntActiQ96F85. 1 interaction.
STRINGi9606.ENSP00000263655.

Structurei

3D structure databases

ProteinModelPortaliQ96F85.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CNRIP family.Curated

Phylogenomic databases

eggNOGiENOG410IK8D. Eukaryota.
ENOG41123ZA. LUCA.
GeneTreeiENSGT00390000004284.
HOGENOMiHOG000089982.
HOVERGENiHBG056498.
InParanoidiQ96F85.
OMAiRQPIQVN.
OrthoDBiEOG091G0QCP.
PhylomeDBiQ96F85.
TreeFamiTF332485.

Family and domain databases

InterProiIPR029204. CNRIP1.
[Graphical view]
PfamiPF15043. CNRIP1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F85-1) [UniParc]FASTAAdd to basket
Also known as: CRIP1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDLPGLVRL SIALRIQPND GPVFYKVDGQ RFGQNRTIKL LTGSSYKVEV
60 70 80 90 100
KIKPSTLQVE NISIGGVLVP LELKSKEPDG DRVVYTGTYD TEGVTPTKSG
110 120 130 140 150
ERQPIQITMP FTDIGTFETV WQVKFYNYHK RDHCQWGSPF SVIEYECKPN
160
ETRSLMWVNK ESFL
Length:164
Mass (Da):18,648
Last modified:December 1, 2001 - v1
Checksum:iAB8432C13F44FF04
GO
Isoform 2 (identifier: Q96F85-2) [UniParc]FASTAAdd to basket
Also known as: CRIP1b

The sequence of this isoform differs from the canonical sequence as follows:
     111-164: FTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL → ECLEQRPQEISLTYECEE

Show »
Length:128
Mass (Da):14,224
Checksum:i7D788CA2C3CC4B32
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti16 – 161I → T in CAB53688 (PubMed:17974005).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei111 – 16454FTDIG…KESFL → ECLEQRPQEISLTYECEE in isoform 2. 1 PublicationVSP_035598Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY144596 mRNA. Translation: AAN41658.1.
AK311784 mRNA. Translation: BAG34727.1.
AC015969 Genomic DNA. Translation: AAX93120.1.
CH471053 Genomic DNA. Translation: EAW99877.1.
BC011535 mRNA. Translation: AAH11535.1.
AL110235 mRNA. Translation: CAB53688.1.
CCDSiCCDS1886.1. [Q96F85-1]
CCDS46311.1. [Q96F85-2]
PIRiT14768.
RefSeqiNP_001104571.1. NM_001111101.1. [Q96F85-2]
NP_056278.1. NM_015463.2. [Q96F85-1]
XP_005264306.1. XM_005264249.1. [Q96F85-1]
XP_006712047.1. XM_006711984.1. [Q96F85-1]
UniGeneiHs.212885.

Genome annotation databases

EnsembliENST00000263655; ENSP00000263655; ENSG00000119865. [Q96F85-1]
ENST00000409559; ENSP00000386883; ENSG00000119865. [Q96F85-2]
GeneIDi25927.
KEGGihsa:25927.
UCSCiuc002sej.5. human. [Q96F85-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY144596 mRNA. Translation: AAN41658.1.
AK311784 mRNA. Translation: BAG34727.1.
AC015969 Genomic DNA. Translation: AAX93120.1.
CH471053 Genomic DNA. Translation: EAW99877.1.
BC011535 mRNA. Translation: AAH11535.1.
AL110235 mRNA. Translation: CAB53688.1.
CCDSiCCDS1886.1. [Q96F85-1]
CCDS46311.1. [Q96F85-2]
PIRiT14768.
RefSeqiNP_001104571.1. NM_001111101.1. [Q96F85-2]
NP_056278.1. NM_015463.2. [Q96F85-1]
XP_005264306.1. XM_005264249.1. [Q96F85-1]
XP_006712047.1. XM_006711984.1. [Q96F85-1]
UniGeneiHs.212885.

3D structure databases

ProteinModelPortaliQ96F85.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117427. 9 interactions.
IntActiQ96F85. 1 interaction.
STRINGi9606.ENSP00000263655.

PTM databases

iPTMnetiQ96F85.
PhosphoSiteiQ96F85.

Polymorphism and mutation databases

BioMutaiCNRIP1.

2D gel databases

UCD-2DPAGEQ96F85.

Proteomic databases

EPDiQ96F85.
MaxQBiQ96F85.
PaxDbiQ96F85.
PeptideAtlasiQ96F85.
PRIDEiQ96F85.

Protocols and materials databases

DNASUi25927.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000263655; ENSP00000263655; ENSG00000119865. [Q96F85-1]
ENST00000409559; ENSP00000386883; ENSG00000119865. [Q96F85-2]
GeneIDi25927.
KEGGihsa:25927.
UCSCiuc002sej.5. human. [Q96F85-1]

Organism-specific databases

CTDi25927.
GeneCardsiCNRIP1.
HGNCiHGNC:24546. CNRIP1.
HPAiHPA035337.
neXtProtiNX_Q96F85.
PharmGKBiPA162382635.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IK8D. Eukaryota.
ENOG41123ZA. LUCA.
GeneTreeiENSGT00390000004284.
HOGENOMiHOG000089982.
HOVERGENiHBG056498.
InParanoidiQ96F85.
OMAiRQPIQVN.
OrthoDBiEOG091G0QCP.
PhylomeDBiQ96F85.
TreeFamiTF332485.

Miscellaneous databases

GenomeRNAii25927.
PROiQ96F85.

Gene expression databases

BgeeiENSG00000119865.
CleanExiHS_CNRIP1.
ExpressionAtlasiQ96F85. baseline and differential.
GenevisibleiQ96F85. HS.

Family and domain databases

InterProiIPR029204. CNRIP1.
[Graphical view]
PfamiPF15043. CNRIP1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCNRP1_HUMAN
AccessioniPrimary (citable) accession number: Q96F85
Secondary accession number(s): B2R4D0, Q49AN4, Q9UFZ0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.