Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

CB1 cannabinoid receptor-interacting protein 1

Gene

CNRIP1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1 suppresses cannabinoid receptor CNR1-mediated tonic inhibition of voltage-gated calcium channels. Isoform 2 does not have this effect.1 Publication

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB
  • type 1 cannabinoid receptor binding Source: UniProtKB

GO - Biological processi

  • negative regulation of signaling receptor activity Source: UniProtKB
  • regulation of signaling receptor activity Source: UniProtKB

Names & Taxonomyi

Protein namesi
Recommended name:
CB1 cannabinoid receptor-interacting protein 1
Short name:
CRIP-1
Gene namesi
Name:CNRIP1
Synonyms:C2orf32
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000119865.8
HGNCiHGNC:24546 CNRIP1
neXtProtiNX_Q96F85

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi25927
OpenTargetsiENSG00000119865
PharmGKBiPA162382635

Polymorphism and mutation databases

BioMutaiCNRIP1

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000893601 – 164CB1 cannabinoid receptor-interacting protein 1Add BLAST164

Proteomic databases

EPDiQ96F85
MaxQBiQ96F85
PaxDbiQ96F85
PeptideAtlasiQ96F85
PRIDEiQ96F85

2D gel databases

UCD-2DPAGEQ96F85

PTM databases

iPTMnetiQ96F85
PhosphoSitePlusiQ96F85

Expressioni

Gene expression databases

BgeeiENSG00000119865
CleanExiHS_CNRIP1
ExpressionAtlasiQ96F85 baseline and differential
GenevisibleiQ96F85 HS

Organism-specific databases

HPAiHPA035337

Interactioni

Subunit structurei

Interacts with the cannabinoid receptor CNR1 (via C-terminus). Does not interact with cannabinoid receptor CNR2.1 Publication

GO - Molecular functioni

  • protein C-terminus binding Source: UniProtKB
  • type 1 cannabinoid receptor binding Source: UniProtKB

Protein-protein interaction databases

BioGridi117427, 9 interactors
IntActiQ96F85, 3 interactors

Structurei

3D structure databases

ProteinModelPortaliQ96F85
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the CNRIP family.Curated

Phylogenomic databases

eggNOGiENOG410IK8D Eukaryota
ENOG41123ZA LUCA
GeneTreeiENSGT00390000004284
HOGENOMiHOG000089982
HOVERGENiHBG056498
InParanoidiQ96F85
OMAiRQPIQVN
OrthoDBiEOG091G0QCP
PhylomeDBiQ96F85
TreeFamiTF332485

Family and domain databases

InterProiView protein in InterPro
IPR029204 CNRIP1
PANTHERiPTHR31952 PTHR31952, 1 hit
PfamiView protein in Pfam
PF15043 CNRIP1, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F85-1) [UniParc]FASTAAdd to basket
Also known as: CRIP1a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGDLPGLVRL SIALRIQPND GPVFYKVDGQ RFGQNRTIKL LTGSSYKVEV
60 70 80 90 100
KIKPSTLQVE NISIGGVLVP LELKSKEPDG DRVVYTGTYD TEGVTPTKSG
110 120 130 140 150
ERQPIQITMP FTDIGTFETV WQVKFYNYHK RDHCQWGSPF SVIEYECKPN
160
ETRSLMWVNK ESFL
Length:164
Mass (Da):18,648
Last modified:December 1, 2001 - v1
Checksum:iAB8432C13F44FF04
GO
Isoform 2 (identifier: Q96F85-2) [UniParc]FASTAAdd to basket
Also known as: CRIP1b

The sequence of this isoform differs from the canonical sequence as follows:
     111-164: FTDIGTFETVWQVKFYNYHKRDHCQWGSPFSVIEYECKPNETRSLMWVNKESFL → ECLEQRPQEISLTYECEE

Show »
Length:128
Mass (Da):14,224
Checksum:i7D788CA2C3CC4B32
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti16I → T in CAB53688 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_035598111 – 164FTDIG…KESFL → ECLEQRPQEISLTYECEE in isoform 2. 1 PublicationAdd BLAST54

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY144596 mRNA Translation: AAN41658.1
AK311784 mRNA Translation: BAG34727.1
AC015969 Genomic DNA Translation: AAX93120.1
CH471053 Genomic DNA Translation: EAW99877.1
BC011535 mRNA Translation: AAH11535.1
AL110235 mRNA Translation: CAB53688.1
CCDSiCCDS1886.1 [Q96F85-1]
CCDS46311.1 [Q96F85-2]
PIRiT14768
RefSeqiNP_001104571.1, NM_001111101.1 [Q96F85-2]
NP_056278.1, NM_015463.2 [Q96F85-1]
XP_005264306.1, XM_005264249.1 [Q96F85-1]
XP_006712047.1, XM_006711984.1 [Q96F85-1]
UniGeneiHs.212885

Genome annotation databases

EnsembliENST00000263655; ENSP00000263655; ENSG00000119865 [Q96F85-1]
ENST00000409559; ENSP00000386883; ENSG00000119865 [Q96F85-2]
GeneIDi25927
KEGGihsa:25927
UCSCiuc002sej.5 human [Q96F85-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiCNRP1_HUMAN
AccessioniPrimary (citable) accession number: Q96F85
Secondary accession number(s): B2R4D0, Q49AN4, Q9UFZ0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: May 23, 2018
This is version 114 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health