Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor-binding factor 2

Gene

NRBF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).1 Publication
Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (PubMed:24785657). Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (PubMed:25086043). May be involved in autophagosome biogenesis (PubMed:25086043). May play a role in neural progenitor cell survival during differentiation (By similarity).By similarity2 Publications

GO - Biological processi

Keywordsi

Biological processAutophagy, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-383280 Nuclear Receptor transcription pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor-binding factor 2
Short name:
NRBF-2
Alternative name(s):
Comodulator of PPAR and RXR
Gene namesi
Name:NRBF2
Synonyms:COPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

EuPathDBiHostDB:ENSG00000148572.14
HGNCiHGNC:19692 NRBF2
MIMi616477 gene
neXtProtiNX_Q96F24

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi144 – 145LL → AA: Decreased interaction with nuclear receptors. 1 Publication2

Organism-specific databases

DisGeNETi29982
OpenTargetsiENSG00000148572
PharmGKBiPA134946285

Polymorphism and mutation databases

DMDMi74731648

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002358161 – 287Nuclear receptor-binding factor 2Add BLAST287

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei113PhosphoserineCombined sources1
Modified residuei268PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96F24
MaxQBiQ96F24
PaxDbiQ96F24
PeptideAtlasiQ96F24
PRIDEiQ96F24
ProteomicsDBi76486
76487 [Q96F24-2]

PTM databases

iPTMnetiQ96F24
PhosphoSitePlusiQ96F24

Expressioni

Tissue specificityi

Detected in keratinocytes, liver and placenta (PubMed:15610520). Expressed in a subset of cells in pediatric medulloblastoma (PubMed:18619852).2 Publications

Gene expression databases

BgeeiENSG00000148572
CleanExiHS_NRBF2
GenevisibleiQ96F24 HS

Organism-specific databases

HPAiHPA021670
HPA059477

Interactioni

Subunit structurei

Interacts with PPARA, PPARD and PPARG. Interacts with RARA, RARG and RXRA in the presence of bound ligand (PubMed:15610520). Interacts with SCOC (PubMed:22354037). Associates with the PI3K complex I (PI3KC3-C1); the direct binding partner in the complex is reported variably as PIK3R4 or ATG14 (PubMed:24785657).4 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi119009, 27 interactors
IntActiQ96F24, 21 interactors
STRINGi9606.ENSP00000277746

Structurei

Secondary structure

1287
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi7 – 23Combined sources17
Helixi27 – 45Combined sources19
Helixi51 – 85Combined sources35

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4ZEYX-ray1.50A4-86[»]
ProteinModelPortaliQ96F24
SMRiQ96F24
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili168 – 209Sequence analysisAdd BLAST42

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi141 – 145Nuclear receptor interaction motif5

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJBN Eukaryota
ENOG4111SDN LUCA
GeneTreeiENSGT00390000000984
HOGENOMiHOG000293418
HOVERGENiHBG056976
InParanoidiQ96F24
KOiK21246
OMAiTWQKFAS
OrthoDBiEOG091G0FJ8
PhylomeDBiQ96F24
TreeFamiTF328627

Family and domain databases

InterProiView protein in InterPro
IPR015056 NRBF2
IPR033393 NRBF2_MIT
PfamiView protein in Pfam
PF08961 NRBF2, 1 hit
PF17169 NRBF2_MIT, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F24-1) [UniParc]FASTAAdd to basket
Also known as: COPR2, Comodulator of PPAR and RXR 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVMEGPLNL AHQQSRRADR LLAAGKYEEA ISCHKKAAAY LSEAMKLTQS
60 70 80 90 100
EQAHLSLELQ RDSHMKQLLL IQERWKRAQR EERLKAQQNT DKDAAAHLQT
110 120 130 140 150
SHKPSAEDAE GQSPLSQKYS PSTEKCLPEI QGIFDRDPDT LLYLLQQKSE
160 170 180 190 200
PAEPCIGSKA PKDDKTIIEE QATKIADLKR HVEFLVAENE RLRKENKQLK
210 220 230 240 250
AEKARLLKGP IEKELDVDAD FVETSELWSL PPHAETATAS STWQKFAANT
260 270 280
GKAKDIPIPN LPPLDFPSPE LPLMELSEDI LKGFMNN
Length:287
Mass (Da):32,378
Last modified:December 1, 2001 - v1
Checksum:i91EC0407F5108806
GO
Isoform 2 (identifier: Q96F24-2) [UniParc]FASTAAdd to basket
Also known as: COPR1, Comodulator of PPAR and RXR 1

The sequence of this isoform differs from the canonical sequence as follows:
     90-139: Missing.

Show »
Length:237
Mass (Da):26,955
Checksum:i71E24C3D4AB955B0
GO
Isoform 3 (identifier: Q96F24-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAA → MFPGATTPLPKAAAYPGVYGSNGRTPQP

Note: No experimental confirmation available.
Show »
Length:277
Mass (Da):31,001
Checksum:iD1F2D74D45441391
GO

Sequence cautioni

The sequence AAG44735 differs from that shown. Reason: Frameshift at positions 234, 251 and 278.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti150E → G in BAB70833 (PubMed:14702039).Curated1
Sequence conflicti284F → L in CAB66591 (PubMed:11230166).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0545551 – 38MEVME…HKKAA → MFPGATTPLPKAAAYPGVYG SNGRTPQP in isoform 3. 1 PublicationAdd BLAST38
Alternative sequenceiVSP_01848890 – 139Missing in isoform 2. 1 PublicationAdd BLAST50

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY267839 mRNA Translation: AAP03081.1
AY267840 mRNA Translation: AAP03082.1
AF267866 mRNA Translation: AAG44735.1 Frameshift.
AL136656 mRNA Translation: CAB66591.1
AK054957 mRNA Translation: BAB70833.1
AK301656 mRNA Translation: BAG63132.1
AL590502 Genomic DNA No translation available.
CH471083 Genomic DNA Translation: EAW54241.1
BC011707 mRNA Translation: AAH11707.1
CCDSiCCDS60537.1 [Q96F24-3]
CCDS7268.1 [Q96F24-1]
RefSeqiNP_001269334.1, NM_001282405.1 [Q96F24-3]
NP_110386.2, NM_030759.4 [Q96F24-1]
UniGeneiHs.449628

Genome annotation databases

EnsembliENST00000277746; ENSP00000277746; ENSG00000148572 [Q96F24-1]
ENST00000435510; ENSP00000397502; ENSG00000148572 [Q96F24-3]
GeneIDi29982
KEGGihsa:29982
UCSCiuc001jmj.6 human [Q96F24-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiNRBF2_HUMAN
AccessioniPrimary (citable) accession number: Q96F24
Secondary accession number(s): A6PW36
, B4DWS0, Q86UR2, Q96NP6, Q9H0S9, Q9H2I2
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: June 20, 2018
This is version 137 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health