Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nuclear receptor-binding factor 2

Gene

NRBF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro).1 Publication
Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy (PubMed:24785657). Stabilzes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3 (By similarity). Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1 (PubMed:25086043). May be involved in autophagosome biogenesis (PubMed:25086043). May play a role in neural progenitor cell survival during differentiation (By similarity).By similarity2 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Autophagy, Transcription, Transcription regulation

Enzyme and pathway databases

ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear receptor-binding factor 2
Short name:
NRBF-2
Alternative name(s):
Comodulator of PPAR and RXR
Gene namesi
Name:NRBF2
Synonyms:COPR
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:19692. NRBF2.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoplasmic vesicle, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi144 – 1452LL → AA: Decreased interaction with nuclear receptors. 1 Publication

Organism-specific databases

PharmGKBiPA134946285.

Polymorphism and mutation databases

DMDMi74731648.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 287287Nuclear receptor-binding factor 2PRO_0000235816Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei113 – 1131PhosphoserineCombined sources
Modified residuei268 – 2681PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96F24.
MaxQBiQ96F24.
PaxDbiQ96F24.
PeptideAtlasiQ96F24.
PRIDEiQ96F24.

PTM databases

iPTMnetiQ96F24.
PhosphoSiteiQ96F24.

Expressioni

Tissue specificityi

Detected in keratinocytes, liver and placenta (PubMed:15610520). Expressed in a subset of cells in pediatric medulloblastoma (PubMed:18619852).2 Publications

Gene expression databases

BgeeiENSG00000148572.
CleanExiHS_NRBF2.
ExpressionAtlasiQ96F24. baseline and differential.
GenevisibleiQ96F24. HS.

Organism-specific databases

HPAiHPA021670.
HPA059477.

Interactioni

Subunit structurei

Interacts with PPARA, PPARD and PPARG. Interacts with RARA, RARG and RXRA in the presence of bound ligand (PubMed:15610520). Interacts with SCOC (PubMed:22354037). Associates with the PI3K complex I (PI3KC3-C1); the direct binding partner in the complex is reported variably as PIK3R4 or ATG14 (PubMed:24785657).4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
C1orf216Q8TAB53EBI-2362014,EBI-747505
PIK3C3Q8NEB911EBI-2362014,EBI-1056470
PIK3R4Q995708EBI-2362014,EBI-1046979

Protein-protein interaction databases

BioGridi119009. 27 interactions.
IntActiQ96F24. 17 interactions.
MINTiMINT-4715689.
STRINGi9606.ENSP00000277746.

Structurei

Secondary structure

1
287
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi7 – 2317Combined sources
Helixi27 – 4519Combined sources
Helixi51 – 8535Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4ZEYX-ray1.50A4-86[»]
ProteinModelPortaliQ96F24.
SMRiQ96F24. Positions 4-86.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili168 – 20942Sequence analysisAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi141 – 1455Nuclear receptor interaction motif

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IJBN. Eukaryota.
ENOG4111SDN. LUCA.
GeneTreeiENSGT00390000000984.
HOGENOMiHOG000293418.
HOVERGENiHBG056976.
InParanoidiQ96F24.
OMAiTWQKFAS.
OrthoDBiEOG091G0FJ8.
PhylomeDBiQ96F24.
TreeFamiTF328627.

Family and domain databases

InterProiIPR015056. NRBF2.
IPR033393. NRBF2_MIT.
[Graphical view]
PfamiPF08961. NRBF2. 1 hit.
PF17169. NRBF2_MIT. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F24-1) [UniParc]FASTAAdd to basket
Also known as: COPR2, Comodulator of PPAR and RXR 2

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEVMEGPLNL AHQQSRRADR LLAAGKYEEA ISCHKKAAAY LSEAMKLTQS
60 70 80 90 100
EQAHLSLELQ RDSHMKQLLL IQERWKRAQR EERLKAQQNT DKDAAAHLQT
110 120 130 140 150
SHKPSAEDAE GQSPLSQKYS PSTEKCLPEI QGIFDRDPDT LLYLLQQKSE
160 170 180 190 200
PAEPCIGSKA PKDDKTIIEE QATKIADLKR HVEFLVAENE RLRKENKQLK
210 220 230 240 250
AEKARLLKGP IEKELDVDAD FVETSELWSL PPHAETATAS STWQKFAANT
260 270 280
GKAKDIPIPN LPPLDFPSPE LPLMELSEDI LKGFMNN
Length:287
Mass (Da):32,378
Last modified:December 1, 2001 - v1
Checksum:i91EC0407F5108806
GO
Isoform 2 (identifier: Q96F24-2) [UniParc]FASTAAdd to basket
Also known as: COPR1, Comodulator of PPAR and RXR 1

The sequence of this isoform differs from the canonical sequence as follows:
     90-139: Missing.

Show »
Length:237
Mass (Da):26,955
Checksum:i71E24C3D4AB955B0
GO
Isoform 3 (identifier: Q96F24-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-38: MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAA → MFPGATTPLPKAAAYPGVYGSNGRTPQP

Note: No experimental confirmation available.
Show »
Length:277
Mass (Da):31,001
Checksum:iD1F2D74D45441391
GO

Sequence cautioni

The sequence AAG44735 differs from that shown. Reason: Frameshift at positions 234, 251 and 278. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti150 – 1501E → G in BAB70833 (PubMed:14702039).Curated
Sequence conflicti284 – 2841F → L in CAB66591 (PubMed:11230166).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3838MEVME…HKKAA → MFPGATTPLPKAAAYPGVYG SNGRTPQP in isoform 3. 1 PublicationVSP_054555Add
BLAST
Alternative sequencei90 – 13950Missing in isoform 2. 1 PublicationVSP_018488Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY267839 mRNA. Translation: AAP03081.1.
AY267840 mRNA. Translation: AAP03082.1.
AF267866 mRNA. Translation: AAG44735.1. Frameshift.
AL136656 mRNA. Translation: CAB66591.1.
AK054957 mRNA. Translation: BAB70833.1.
AK301656 mRNA. Translation: BAG63132.1.
AL590502 Genomic DNA. Translation: CAO03491.1.
CH471083 Genomic DNA. Translation: EAW54241.1.
BC011707 mRNA. Translation: AAH11707.1.
CCDSiCCDS60537.1. [Q96F24-3]
CCDS7268.1. [Q96F24-1]
RefSeqiNP_001269334.1. NM_001282405.1. [Q96F24-3]
NP_110386.2. NM_030759.4. [Q96F24-1]
UniGeneiHs.449628.

Genome annotation databases

EnsembliENST00000277746; ENSP00000277746; ENSG00000148572. [Q96F24-1]
ENST00000435510; ENSP00000397502; ENSG00000148572. [Q96F24-3]
GeneIDi29982.
KEGGihsa:29982.
UCSCiuc001jmj.6. human. [Q96F24-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY267839 mRNA. Translation: AAP03081.1.
AY267840 mRNA. Translation: AAP03082.1.
AF267866 mRNA. Translation: AAG44735.1. Frameshift.
AL136656 mRNA. Translation: CAB66591.1.
AK054957 mRNA. Translation: BAB70833.1.
AK301656 mRNA. Translation: BAG63132.1.
AL590502 Genomic DNA. Translation: CAO03491.1.
CH471083 Genomic DNA. Translation: EAW54241.1.
BC011707 mRNA. Translation: AAH11707.1.
CCDSiCCDS60537.1. [Q96F24-3]
CCDS7268.1. [Q96F24-1]
RefSeqiNP_001269334.1. NM_001282405.1. [Q96F24-3]
NP_110386.2. NM_030759.4. [Q96F24-1]
UniGeneiHs.449628.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4ZEYX-ray1.50A4-86[»]
ProteinModelPortaliQ96F24.
SMRiQ96F24. Positions 4-86.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119009. 27 interactions.
IntActiQ96F24. 17 interactions.
MINTiMINT-4715689.
STRINGi9606.ENSP00000277746.

PTM databases

iPTMnetiQ96F24.
PhosphoSiteiQ96F24.

Polymorphism and mutation databases

DMDMi74731648.

Proteomic databases

EPDiQ96F24.
MaxQBiQ96F24.
PaxDbiQ96F24.
PeptideAtlasiQ96F24.
PRIDEiQ96F24.

Protocols and materials databases

DNASUi29982.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000277746; ENSP00000277746; ENSG00000148572. [Q96F24-1]
ENST00000435510; ENSP00000397502; ENSG00000148572. [Q96F24-3]
GeneIDi29982.
KEGGihsa:29982.
UCSCiuc001jmj.6. human. [Q96F24-1]

Organism-specific databases

CTDi29982.
GeneCardsiNRBF2.
H-InvDBHIX0008862.
HIX0170466.
HGNCiHGNC:19692. NRBF2.
HPAiHPA021670.
HPA059477.
MIMi616477. gene.
neXtProtiNX_Q96F24.
PharmGKBiPA134946285.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJBN. Eukaryota.
ENOG4111SDN. LUCA.
GeneTreeiENSGT00390000000984.
HOGENOMiHOG000293418.
HOVERGENiHBG056976.
InParanoidiQ96F24.
OMAiTWQKFAS.
OrthoDBiEOG091G0FJ8.
PhylomeDBiQ96F24.
TreeFamiTF328627.

Enzyme and pathway databases

ReactomeiR-HSA-383280. Nuclear Receptor transcription pathway.

Miscellaneous databases

ChiTaRSiNRBF2. human.
GeneWikiiNRBF2.
GenomeRNAii29982.
PROiQ96F24.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000148572.
CleanExiHS_NRBF2.
ExpressionAtlasiQ96F24. baseline and differential.
GenevisibleiQ96F24. HS.

Family and domain databases

InterProiIPR015056. NRBF2.
IPR033393. NRBF2_MIT.
[Graphical view]
PfamiPF08961. NRBF2. 1 hit.
PF17169. NRBF2_MIT. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiNRBF2_HUMAN
AccessioniPrimary (citable) accession number: Q96F24
Secondary accession number(s): A6PW36
, B4DWS0, Q86UR2, Q96NP6, Q9H0S9, Q9H2I2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.