Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

GTPase IMAP family member 5

Gene

GIMAP5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Required for mitochondrial integrity and T-cell survival. May contribute to T-cell quiescence (By similarity).By similarity

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Binding sitei55 – 551GTPBy similarity
Binding sitei189 – 1891GTPBy similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Nucleotide bindingi34 – 429GTPBy similarity
Nucleotide bindingi152 – 1543GTPBy similarity

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Names & Taxonomyi

Protein namesi
Recommended name:
GTPase IMAP family member 5
Alternative name(s):
Immunity-associated nucleotide 4-like 1 protein
Immunity-associated nucleotide 5 protein
Short name:
IAN-5
Short name:
hIAN5
Immunity-associated protein 3
Gene namesi
Name:GIMAP5
Synonyms:IAN4L1, IAN5, IMAP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:18005. GIMAP5.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 284284CytoplasmicSequence analysisAdd
BLAST
Transmembranei285 – 30521Helical; Anchor for type IV membrane proteinSequence analysisAdd
BLAST
Topological domaini306 – 3072LumenalSequence analysis

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Lysosome, Membrane, Mitochondrion, Mitochondrion outer membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA29578.

Polymorphism and mutation databases

BioMutaiGIMAP5.
DMDMi38372381.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 307307GTPase IMAP family member 5PRO_0000190990Add
BLAST

Proteomic databases

MaxQBiQ96F15.
PaxDbiQ96F15.
PeptideAtlasiQ96F15.
PRIDEiQ96F15.

PTM databases

iPTMnetiQ96F15.
PhosphoSiteiQ96F15.

Expressioni

Tissue specificityi

Widely expressed with high levels in lymph node and spleen. High expression found in CD4 and CD8-positive T-cells and monocytes with very low levels in B-lymphocytes. Highly expressed in B-lymphocyte-derived neoplasms.1 Publication

Gene expression databases

BgeeiENSG00000196329.
CleanExiHS_GIMAP5.
ExpressionAtlasiQ96F15. baseline and differential.
GenevisibleiQ96F15. HS.

Organism-specific databases

HPAiHPA015102.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
EDAQ928383EBI-6166686,EBI-529425
GRAMD3Q96HH93EBI-6166686,EBI-2832937
LDLRAD1Q5T7003EBI-6166686,EBI-10173166
LSMEM2Q8N1123EBI-6166686,EBI-10264855
STX4Q128463EBI-6166686,EBI-744942

Protein-protein interaction databases

BioGridi120621. 13 interactions.
DIPiDIP-59484N.
IntActiQ96F15. 6 interactions.
MINTiMINT-4658444.
STRINGi9606.ENSP00000351473.

Structurei

3D structure databases

ProteinModelPortaliQ96F15.
SMRiQ96F15. Positions 27-280.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini25 – 228204AIG1-type GAdd
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410JA52. Eukaryota.
ENOG411152A. LUCA.
GeneTreeiENSGT00760000118989.
HOGENOMiHOG000115747.
HOVERGENiHBG004016.
InParanoidiQ96F15.
OrthoDBiEOG091G0I0X.
PhylomeDBiQ96F15.
TreeFamiTF330845.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR006703. G_AIG1.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF04548. AIG1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51720. G_AIG1. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96F15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGGFQRGKYG TMAEGRSEDN LSATPPALRI ILVGKTGCGK SATGNSILGQ
60 70 80 90 100
PVFESKLRAQ SVTRTCQVKT GTWNGRKVLV VDTPSIFESQ ADTQELYKNI
110 120 130 140 150
GDCYLLSAPG PHVLLLVIQL GRFTAQDTVA IRKVKEVFGT GAMRHVVILF
160 170 180 190 200
THKEDLGGQA LDDYVANTDN CSLKDLVREC ERRYCAFNNW GSVEEQRQQQ
210 220 230 240 250
AELLAVIERL GREREGSFHS NDLFLDAQLL QRTGAGACQE DYRQYQAKVE
260 270 280 290 300
WQVEKHKQEL RENESNWAYK ALLRVKHLML LHYEIFVFLL LCSILFFIIF

LFIFHYI
Length:307
Mass (Da):34,846
Last modified:December 1, 2001 - v1
Checksum:iD219F52DE910C5BA
GO
Isoform 2 (identifier: Q96F15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-14: MGGFQRGKYGTMAE → MQDSPIVVCTLLCTHKYVYHSGEDVHSFHEITMNNDLTVLRIINLVRYKTSFST

Note: No experimental confirmation available.
Show »
Length:347
Mass (Da):39,584
Checksum:i9C2731FBA4341BC9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti174 – 1741K → E in BAA92115 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 1414MGGFQ…GTMAE → MQDSPIVVCTLLCTHKYVYH SGEDVHSFHEITMNNDLTVL RIINLVRYKTSFST in isoform 2. 1 PublicationVSP_008961Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002158 mRNA. Translation: BAA92115.1.
AK055568 mRNA. Translation: BAB70958.1.
CR457280 mRNA. Translation: CAG33561.1.
CH471173 Genomic DNA. Translation: EAW54092.1.
CH471173 Genomic DNA. Translation: EAW54093.1.
CH471173 Genomic DNA. Translation: EAW54094.1.
BC011732 mRNA. Translation: AAH11732.1.
CCDSiCCDS5907.1. [Q96F15-1]
RefSeqiNP_060854.2. NM_018384.4. [Q96F15-1]
UniGeneiHs.647079.
Hs.698139.

Genome annotation databases

EnsembliENST00000358647; ENSP00000351473; ENSG00000196329. [Q96F15-1]
ENST00000498181; ENSP00000487840; ENSG00000196329. [Q96F15-1]
GeneIDi55340.
KEGGihsa:55340.
UCSCiuc003whr.3. human. [Q96F15-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002158 mRNA. Translation: BAA92115.1.
AK055568 mRNA. Translation: BAB70958.1.
CR457280 mRNA. Translation: CAG33561.1.
CH471173 Genomic DNA. Translation: EAW54092.1.
CH471173 Genomic DNA. Translation: EAW54093.1.
CH471173 Genomic DNA. Translation: EAW54094.1.
BC011732 mRNA. Translation: AAH11732.1.
CCDSiCCDS5907.1. [Q96F15-1]
RefSeqiNP_060854.2. NM_018384.4. [Q96F15-1]
UniGeneiHs.647079.
Hs.698139.

3D structure databases

ProteinModelPortaliQ96F15.
SMRiQ96F15. Positions 27-280.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120621. 13 interactions.
DIPiDIP-59484N.
IntActiQ96F15. 6 interactions.
MINTiMINT-4658444.
STRINGi9606.ENSP00000351473.

PTM databases

iPTMnetiQ96F15.
PhosphoSiteiQ96F15.

Polymorphism and mutation databases

BioMutaiGIMAP5.
DMDMi38372381.

Proteomic databases

MaxQBiQ96F15.
PaxDbiQ96F15.
PeptideAtlasiQ96F15.
PRIDEiQ96F15.

Protocols and materials databases

DNASUi55340.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000358647; ENSP00000351473; ENSG00000196329. [Q96F15-1]
ENST00000498181; ENSP00000487840; ENSG00000196329. [Q96F15-1]
GeneIDi55340.
KEGGihsa:55340.
UCSCiuc003whr.3. human. [Q96F15-1]

Organism-specific databases

CTDi55340.
GeneCardsiGIMAP5.
HGNCiHGNC:18005. GIMAP5.
HPAiHPA015102.
MIMi608086. gene.
neXtProtiNX_Q96F15.
PharmGKBiPA29578.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410JA52. Eukaryota.
ENOG411152A. LUCA.
GeneTreeiENSGT00760000118989.
HOGENOMiHOG000115747.
HOVERGENiHBG004016.
InParanoidiQ96F15.
OrthoDBiEOG091G0I0X.
PhylomeDBiQ96F15.
TreeFamiTF330845.

Miscellaneous databases

GeneWikiiGIMAP5.
GenomeRNAii55340.
PROiQ96F15.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000196329.
CleanExiHS_GIMAP5.
ExpressionAtlasiQ96F15. baseline and differential.
GenevisibleiQ96F15. HS.

Family and domain databases

Gene3Di3.40.50.300. 1 hit.
InterProiIPR006703. G_AIG1.
IPR027417. P-loop_NTPase.
[Graphical view]
PfamiPF04548. AIG1. 1 hit.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
PROSITEiPS51720. G_AIG1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiGIMA5_HUMAN
AccessioniPrimary (citable) accession number: Q96F15
Secondary accession number(s): D3DWZ5
, Q6IA75, Q96NE4, Q9NUK9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: November 14, 2003
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 124 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.