Reviewed,
UniProtKB/Swiss-Prot Q96EW2 (HBAP1_HUMAN)
Last modified
June 16, 2009.
Version 43.
History...
Clusters with 100%,
90%,
50% identity |
Documents (5) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: HSPB1-associated protein 1 Alternative name(s): 27 KdA heat shock protein-associated protein 1 Protein associated with small stress protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 488 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May play a role in cellular stress response By similarity. |
| Subunit structure | Interacts with CRYAB and HSPB1. Ref.4 |
| Subcellular location | Cytoplasm By similarity. |
| Tissue specificity | Widely expressed. Ref.1 |
| Involvement in disease | A chromosomal aberration involving HSPBAP1 is found in familial renal cell carcinoma 1 (RCC1) [MIM:144700]. Translocation t(2;3)(q35;q21) with the putative pseudogene DIRC3. Produces an hybrid mRNA encoding a truncated HSPBAP1 lacking the first 36 amino acids. |
| Sequence similarities | Contains 1 JmjC domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Chromosomal rearrangement Polymorphism |
| Gene Ontology (GO) | |
| Cellular component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96EW2-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96EW2-2) The sequence of this isoform differs from the canonical sequence as follows: 191-225: KRWHLFPPEDTPFLYPTRIPYEESSVFSKINVVNP → LECNGMIIAPGPQAILLPQPLKYLGLQETMASLSS 226-488: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96EW2-3) The sequence of this isoform differs from the canonical sequence as follows: 250-280: FVPRHWWHYVESIDPVTVSINSWIELEEDHL → ERKWQEGTQLLLLVKRRMDFGGRQSTRVIFI 281-488: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 488 | 488 | HSPB1-associated protein 1 | PRO_0000284113 | |||||
Regions | |||||||||
| Domain | 124 – 288 | 165 | JmjC | ||||||
| Region | 88 – 208 | 121 | Interaction with HSPB1 By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 191 – 225 | 35 | KRWHL…NVVNP → LECNGMIIAPGPQAILLPQP LKYLGLQETMASLSS in isoform 2. | VSP_024442 | |||||
| Alternative sequence | 226 – 488 | 263 | Missing in isoform 2. | VSP_024443 | |||||
| Alternative sequence | 250 – 280 | 31 | FVPRH…EEDHL → ERKWQEGTQLLLLVKRRMDF GGRQSTRVIFI in isoform 3. | VSP_024444 | |||||
| Alternative sequence | 281 – 488 | 208 | Missing in isoform 3. | VSP_024445 | |||||
| Natural variant | 64 | 1 | S → A: dbSNP rs16833517. | VAR_031703 | |||||
Experimental info | |||||||||
| Sequence conflict | 46 | 1 | F → L in BAC04847. Ref.2 | ||||||
| Sequence conflict | 320 | 1 | V → A in AAM64044. Ref.1 | ||||||
| Sequence conflict | 456 | 1 | P → PS in AAH17763. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning and characterization of a novel human gene (HSPBAP1) from human fetal brain." Jiang M., Ma Y., Cheng H., Ni X., Guo L., Xie Y., Mao Y. Cytogenet. Cell Genet. 95:48-51(2001) [PubMed: 11978969] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Fetal brain. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Placenta. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lung, Ovary and Prostate. |
| [4] | "Identification and characterization of a novel protein from Sertoli cells, PASS1, that associates with mammalian small stress protein hsp27." Liu C., Gilmont R.R., Benndorf R., Welsh M.J. J. Biol. Chem. 275:18724-18731(2000) [PubMed: 10751411] [Abstract] Cited for: INTERACTION WITH CRYAB AND HSPB1. |
| [5] | "Disruption of a novel gene, DIRC3, and expression of DIRC3-HSPBAP1 fusion transcripts in a case of familial renal cell cancer and t(2;3)(q35;q21)." Bodmer D., Schepens M., Eleveld M.J., Schoenmakers E.F.P.M., Geurts van Kessel A. Genes Chromosomes Cancer 38:107-116(2003) [PubMed: 12939738] [Abstract] Cited for: CHROMOSOMAL TRANSLOCATION WITH DIRC3. |
Cross-references
Sequence databases | |
|---|---|
| AF400663 mRNA. Translation: AAM64044.1. AK096705 mRNA. Translation: BAC04847.1. BC011897 mRNA. Translation: AAH11897.1. BC017763 mRNA. Translation: AAH17763.1. Different initiation. BC063629 mRNA. Translation: AAH63629.1. | |
| IPI | IPI00298207. IPI00303932. IPI00440544. |
| RefSeq | NP_078886.2. |
| UniGene | Hs.29169 |
3D structure databases | |
| HSSP | HSSP built from PDB template 1MZF based on UniProtKB Q9NWT6. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96EW2. 1 interaction. |
Proteomic databases | |
| PRIDE | Q96EW2. |
Genome annotation databases | |
| Ensembl | ENSG00000169087. Homo sapiens. [Contig view] |
| GeneID | 79663. |
| KEGG | hsa:79663. |
Organism-specific databases | |
| GeneCards | GC03M123941. |
| HGNC | HGNC:16389. HSPBAP1. |
| MIM | 144700. phenotype. 608263. gene. |
| Orphanet | 151. Renal cell carcinoma, familial. |
| PharmGKB | PA29515. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q96EW2. |
Gene expression databases | |
| ArrayExpress | Q96EW2. |
| Bgee | Q96EW2. |
| CleanEx | HS_HSPBAP1. |
Family and domain databases | |
| InterPro | IPR013296. PASS1. IPR013129. TF_JmjC. IPR003347. TF_JmjC_AAH. [Graphical view] |
| Pfam | PF02373. JmjC. 1 hit. [Graphical view] |
| PRINTS | PR01886. PASS1. |
| SMART | SM00558. JmjC. 1 hit. [Graphical view] |
| PROSITE | PS51184. JMJC. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 68856. |
| SOURCE | Search... |
Entry information
| Entry name | HBAP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96EW2 Secondary accession number(s): Q6P476 Q8WWF0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 3 Human chromosome 3: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


