Q96EV8 (DTBP1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 106.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Dysbindin Alternative name(s): Biogenesis of lysosome-related organelles complex 1 subunit 8 Short name=BLOC-1 subunit 8 Dysbindin-1 Dystrobrevin-binding protein 1 Hermansky-Pudlak syndrome 7 protein Short name=HPS7 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 351 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Associates with the BLOC-2 complex to facilitate the transport of TYRP1 independent of AP-3 function. Plays a role in synaptic vesicle trafficking and in neurotransmitter release. Plays a role in the regulation of cell surface exposure of DRD2. May play a role in actin cytoskeleton reorganization and neurite outgrowth. May modulate MAPK8 phosphorylation. Appears to promote neuronal transmission and viability through regulating the expression of SNAP25 and SYN1, modulating PI3-kinase-Akt signaling and influencing glutamatergic release. Regulates the expression of SYN1 through binding to its promoter. Modulates prefrontal cortical activity via the dopamine/D2 pathway. Ref.8 Ref.11 Ref.12 Ref.13 Ref.18 Ref.22 Ref.23 |
| Subunit structure | Interacts (via its coiled coil domain) with KXD1. Interacts with CMYA5, PI4K2 and RNF151 By similarity. Component of the biogenesis of lysosome-related organelles complex 1 (BLOC-1) composed of at least BLOC1S1, BLOC1S2, BLOC1S3, BLOC1S4, BLOC1S5, BLOC1S6, DTNBP1/BLOC1S7 and SNAPIN/BLOC1S8. Interacts directly in the complex with BLOC1S5, BLOC1S6 and SNAPIN/BLOC1S8. The BLOC-1 complex associates with the AP-3 protein complex and membrane protein cargos. This BLOC-1 complex also associates with the BLOC-2 complex in endosomes. Binds to DTNA and DTNB but may not be a physiological binding partner (Ref.10). Interacts (isoform 1 and isoform 2 only) with the DNA-dependent protein kinase complex DNA-PK; the interaction phosphorylates DTNBP1 in vitro. Interacts directly in this complex with XRCC5 and XRCC6. Interacts with AP3M1, AP3B2 and TRIM32. Interacts with XPO1; the interaction exports DTNBP1 out of the nucleus. Ref.11 Ref.12 Ref.19 Ref.20 Ref.21 Ref.23 Ref.26 |
| Subcellular location | Isoform 1: Cytoplasm. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Melanosome membrane; Peripheral membrane protein; Cytoplasmic side. Cell junction › synapse › postsynaptic cell membrane › postsynaptic density. Endoplasmic reticulum By similarity. Nucleus. Note: Mainly cytoplasmic but shuttles between the cytoplasm and nucleus. Exported out of the nucleus via its NES in a XPO1-dependent manner. Nuclear localization is required for regulation of the expresssion of genes such as SYN1. Detected in neuron cell bodies, axons and dendrites. Mainly located to the postsynaptic density. Detected at tubulovesicular elements in the vicinity of the Golgi apparatus and of melanosomes. Occasionally detected at the membrane of pigmented melanosomes in cultured melanoma cells. The BLOC-1 complex associates with the BLOC-2 complex in early endosome-associated tubules. Ref.9 Ref.10 Ref.11 Ref.19 Ref.21 Ref.23 Ref.25 Isoform 2: Cytoplasm. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Melanosome membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cell junction › synapse › postsynaptic cell membrane. Endoplasmic reticulum By similarity. Nucleus. Note: Shuttles between the cytoplasm and nucleus. Exported out of the nucleus via its NES in a XPO1-dependent manner. Nuclear localization is required for regulation of the expresssion of genes such as SYN1. Mainly expressed in the dendritic spine. Predominantly a synaptic vesicle isoform but also highly expressed in the nucleus. The BLOC-1 complex associates with the BLOC-2 complex in early endosome-associated tubules. Associated with the AP-3 complex at presynaptic terminals. Ref.9 Ref.10 Ref.11 Ref.19 Ref.21 Ref.23 Ref.25 Isoform 3: Cytoplasm. Cytoplasmic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasmic vesicle › secretory vesicle › synaptic vesicle membrane; Peripheral membrane protein; Cytoplasmic side. Endosome membrane; Peripheral membrane protein; Cytoplasmic side. Melanosome membrane; Peripheral membrane protein; Cytoplasmic side By similarity. Cell junction › synapse › postsynaptic cell membrane. Endoplasmic reticulum By similarity. Note: Exclusivley cytoplasmic. Predominantly found in the postsynaptic density (PSD). Little association with synaptic vesicles. The BLOC-1 complex associates with the BLOC-2 complex in early endosome-associated tubules. Associated with the AP-3 complex at presynaptic terminals. Ref.9 Ref.10 Ref.11 Ref.19 Ref.21 Ref.23 Ref.25 |
| Tissue specificity | Detected in brain, in neurons and in neuropil. Isoform 1 is expressed in the cerebral cortex, and hippocampal frontal (HF). Specific expression in the posterior half of the superior temporal gyrus (pSTG). Higher expression of isoform 2 and 3 in the HF than in the pSTG while isoform 1 shows no difference in expression in these areas. In the HF, detected in dentate gyrus (DG) and in pyramidal cells of hippocampus CA2 and CA3 (at protein level). Expressed in all principal neuronal populations of the HF, namely pyramidal neurons in the subiculum and CA1-3, granule cells in the dense cell layer of the DG (DGg), and polymorph cells in the hilus of the DG (DGh). Maximal levels in CA2, CA3, and DGh. Isoform 2 not expressed in the cerebral cortex. Ref.9 Ref.10 Ref.25 |
| Post-translational modification | Acetylated in the N-terminal. Ubiquitinated by TRIM32. Ubiquitination leads to DTNBP1 degradation. Ref.19 Isoforms 1 and 2 highly phosphorylated by PRKDC in vitro. Isoform 3 only weakly phosphorylated by PRKDC in vitro. Ref.21 |
| Involvement in disease | Hermansky-Pudlak syndrome 7 (HPS7) [MIM:614076]: A form of Hermansky-Pudlak syndrome, a genetically heterogeneous autosomal recessive disorder characterized by oculocutaneous albinism, bleeding due to platelet storage pool deficiency, and lysosomal storage defects. This syndrome results from defects of diverse cytoplasmic organelles including melanosomes, platelet dense granules and lysosomes. Ceroid storage in the lungs is associated with pulmonary fibrosis, a common cause of premature death in individuals with HPS. Defects in DTNBP1 are associated with susceptibility to schizophrenia, a mental disorder characterized by a breakdown of thought processes and by poor emotional responsiveness. Genetic mutations lead to alterations in the glutamatergic transmisssion in the brain and modified Akt signaling (Ref.8). Protein levels and expression are reduced in nerve terminals of the hippocampus and there is an increased release of glutamate in schizophrenic patients (Ref.9). Levels of isoform 1 are reduced in the pSTG, but not in HF, by about 48% in 92% of schizophrenic patients. In the HF, there is an average of 33% reduction in synaptic expression of isoform 2 in 67% of cases, and of isoform 3, an average reduction of 35% in 80% of cases. In the dorsolateral prefrontal cortex (DLPFC), significant reductions in levels of isoform 3 are observed about 71% of schizophrenic patients showed an average reduction of this isoform of about 60% (Ref.15). |
| Sequence similarities | Belongs to the dysbindin family. |
| Sequence caution | The sequence AAG43145.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BLOC1S1 | P78537 | 3 | EBI-465804,EBI-348630 | |
| BLOC1S2 | Q6QNY1 | 6 | EBI-465804,EBI-465872 | |
| BLOC1S3 | Q6QNY0 | 3 | EBI-465804,EBI-465930 | |
| BLOC1S5 | Q8TDH9 | 3 | EBI-465804,EBI-465861 | |
| BLOC1S6 | Q9UL45 | 6 | EBI-465804,EBI-465781 | |
| SNAPIN | O95295 | 4 | EBI-465804,EBI-296723 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing and alternative initiation. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96EV8-1) Also known as: Dysbindin 1-A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Major isoform. | ||||||
| Isoform 2 (identifier: Q96EV8-2) The sequence of this isoform differs from the canonical sequence as follows: 272-351: PESSTCQNEI...TPDGGEDSDS → RVDKLALAEPGQYRCHSPPKVRRENHLPVTYA | ||||||
| Note: May be due to intron retention. | ||||||
| Isoform 3 (identifier: Q96EV8-3) Also known as: Dysbindin 1-B; The sequence of this isoform differs from the canonical sequence as follows: 1-81: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 351 | 351 | Dysbindin | PRO_0000191001 | |||||
Regions | |||||||||
| Region | 173 – 331 | 159 | Dysbindin | ||||||
| Region | 243 – 256 | 14 | Nuclear export signal | ||||||
| Coiled coil | 88 – 181 | 94 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 31 | 1 | N6-acetyllysine | ||||||
| Modified residue | 33 | 1 | N6-acetyllysine | ||||||
| Modified residue | 35 | 1 | N6-acetyllysine | ||||||
| Modified residue | 316 | 1 | Phosphoserine Ref.14 Ref.16 | ||||||
| Modified residue | 321 | 1 | Phosphoserine Ref.14 Ref.16 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 81 | 81 | Missing in isoform 3. | VSP_046062 | |||||
| Alternative sequence | 272 – 351 | 80 | PESST…EDSDS → RVDKLALAEPGQYRCHSPPK VRRENHLPVTYA in isoform 2. | VSP_009023 | |||||
| Natural variant | 214 | 1 | G → D. Corresponds to variant rs16876589 [ dbSNP | Ensembl ]. | VAR_053069 | |||||
| Natural variant | 272 | 1 | P → S. Corresponds to variant rs17470454 [ dbSNP | Ensembl ]. | VAR_029644 | |||||
Experimental info | |||||||||
| Mutagenesis | 215 | 1 | Y → A: Reduced interaction with AP3M1. Ref.20 | ||||||
| Mutagenesis | 243 – 256 | 14 | LMDIS…LDVFL → AMDASDQEAADVFA: Abolishes cytoplasmic location. Increased expression of SYN1. Ref.23 | ||||||
| Sequence conflict | 242 | 1 | D → V in CAB66572. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Hermansky-Pudlak syndrome type 7 (HPS-7) results from mutant dysbindin, a member of the biogenesis of lysosome-related organelles complex 1 (BLOC-1)." Li W., Zhang Q., Oiso N., Novak E.K., Gautam R., O'Brien E.P., Tinsley C.L., Blake D.J., Spritz R.A., Copeland N.G., Jenkins N.A., Amato D., Roe B.A., Starcevic M., Dell'Angelica E.C., Elliott R.W., Mishra V., Kingsmore S.F., Paylor R.E., Swank R.T. Nat. Genet. 35:84-89(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INVOLVEMENT IN HPS7. Tissue: Placenta. |
| [2] | "Localization and identification of a human DTNBP1 gene from a putative schizophrenia susceptibility locus on 6p22.3 by in silico cloning." Jiang Y., Straub R.E., Sullivan P.F., Chen X., O'Neill F.A., Walsh D., Kendler K.S., Riley B.P. Submitted (JUN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Brain. |
| [3] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lung and Neuroblastoma. |
| [5] | "The DNA sequence and analysis of human chromosome 6." Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. Beck S.Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Muscle. |
| [7] | Mao Y.M., Xie Y., Ying K. Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 109-351 (ISOFORM 1). Tissue: Fetal brain. |
| [8] | "Evidence of novel neuronal functions of dysbindin, a susceptibility gene for schizophrenia." Numakawa T., Yagasaki Y., Ishimoto T., Okada T., Suzuki T., Iwata N., Ozaki N., Taguchi T., Tatsumi M., Kamijima K., Straub R.E., Weinberger D.R., Kunugi H., Hashimoto R. Hum. Mol. Genet. 13:2699-2708(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH SCHIZOPHRENIA, FUNCTION. |
| [9] | "Dysbindin-1 is reduced in intrinsic, glutamatergic terminals of the hippocampal formation in schizophrenia." Talbot K., Eidem W.L., Tinsley C.L., Benson M.A., Thompson E.W., Smith R.J., Hahn C.G., Siegel S.J., Trojanowski J.Q., Gur R.E., Blake D.J., Arnold S.E. J. Clin. Invest. 113:1353-1363(2004) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH SCHIZOPHRENIA, TISSUE SPECIFICITY (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION. |
| [10] | "Dysbindin-1 is a synaptic and microtubular protein that binds brain snapin." Talbot K., Cho D.S., Ong W.Y., Benson M.A., Han L.Y., Kazi H.A., Kamins J., Hahn C.G., Blake D.J., Arnold S.E. Hum. Mol. Genet. 15:3041-3054(2006) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, SUBCELLULAR LOCATION. |
| [11] | "BLOC-1 interacts with BLOC-2 and the AP-3 complex to facilitate protein trafficking on endosomes." Di Pietro S.M., Falcon-Perez J.M., Tenza D., Setty S.R., Marks M.S., Raposo G., Dell'Angelica E.C. Mol. Biol. Cell 17:4027-4038(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBUNIT, SUBCELLULAR LOCATION. |
| [12] | "BLOC-1 is required for cargo-specific sorting from vacuolar early endosomes toward lysosome-related organelles." Setty S.R., Tenza D., Truschel S.T., Chou E., Sviderskaya E.V., Theos A.C., Lamoreux M.L., Di Pietro S.M., Starcevic M., Bennett D.C., Dell'Angelica E.C., Raposo G., Marks M.S. Mol. Biol. Cell 18:768-780(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE BLOC-1 COMPLEX, FUNCTION. |
| [13] | "Evidence that the BLOC-1 protein dysbindin modulates dopamine D2 receptor internalization and signaling but not D1 internalization." Iizuka Y., Sei Y., Weinberger D.R., Straub R.E. J. Neurosci. 27:12390-12395(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [14] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-316 AND SER-321, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [15] | "Dysbindin-1 in dorsolateral prefrontal cortex of schizophrenia cases is reduced in an isoform-specific manner unrelated to dysbindin-1 mRNA expression." Tang J., LeGros R.P., Louneva N., Yeh L., Cohen J.W., Hahn C.G., Blake D.J., Arnold S.E., Talbot K. Hum. Mol. Genet. 18:3851-3863(2009) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH SCHIZOPHRENIA. |
| [16] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-316 AND SER-321, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "Dysbindin-1 and its protein family with special attention to the potential role of dysbindin-1 in neuronal functions and the pathophysiology of schizophrenia." Talbot K., Ong W.-Y., Blake D.J., Tang J., Louneva N., Carlson G.C., Arnold S.E. (In) Javitt D.C., Kantrowitz J. (eds.); Handbook of neurochemistry and molecular neurobiology (3rd ed.), pp.27:107-241, Springer Science, New York (2009) Cited for: REVIEW. |
| [18] | "Dysbindin engages in c-Jun N-terminal kinase activity and cytoskeletal organization." Kubota K., Kumamoto N., Matsuzaki S., Hashimoto R., Hattori T., Okuda H., Takamura H., Takeda M., Katayama T., Tohyama M. Biochem. Biophys. Res. Commun. 379:191-195(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [19] | "TRIM32 is an E3 ubiquitin ligase for dysbindin." Locke M., Tinsley C.L., Benson M.A., Blake D.J. Hum. Mol. Genet. 18:2344-2358(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH TRIM32, SUBCELLULAR LOCATION, UBIQUITINATION. |
| [20] | "Direct interaction of dysbindin with the AP-3 complex via its mu subunit." Taneichi-Kuroda S., Taya S., Hikita T., Fujino Y., Kaibuchi K. Neurochem. Int. 54:431-438(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH AP3M1, MUTAGENESIS OF TYR-215. |
| [21] | "Dysbindin-1, a schizophrenia-related protein, functionally interacts with the DNA-dependent protein kinase complex in an isoform-dependent manner." Oyama S., Yamakawa H., Sasagawa N., Hosoi Y., Futai E., Ishiura S. PLoS ONE 4:E4199-E4199(2009) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, ALTERNATIVE SPLICING (ISOFORMS 1; 2 AND 3), INTERACTION WITH AP3B2; XRCC5 AND XRCC6 IN THE DNA-DEPENDENT PROTEIN KINASE COMPLEX DNA-PK, PHOSPHORYLATION. |
| [22] | "DTNBP1 (dysbindin) gene variants modulate prefrontal brain function in schizophrenic patients--support for the glutamate hypothesis of schizophrenias." Fallgatter A.J., Ehlis A.C., Herrmann M.J., Hohoff C., Reif A., Freitag C.M., Deckert J. Genes Brain Behav. 9:489-497(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH SCHIZOPHRENIA, FUNCTION. |
| [23] | "Nucleocytoplasmic shuttling of dysbindin-1, a schizophrenia-related protein, regulates synapsin I expression." Fei E., Ma X., Zhu C., Xue T., Yan J., Xu Y., Zhou J., Wang G. J. Biol. Chem. 285:38630-38640(2010) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, FUNCTION, INTERACTION WITH XPO1, MUTAGENESIS OF 243-LEU--LEU-256. |
| [24] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [25] | "Synaptic dysbindin-1 reductions in schizophrenia occur in an isoform-specific manner indicating their subsynaptic location." Talbot K., Louneva N., Cohen J.W., Kazi H., Blake D.J., Arnold S.E. PLoS ONE 6:E16886-E16886(2011) [PubMed] [Europe PMC] [Abstract] Cited for: ASSOCIATION WITH SCHIZOPHRENIA, TISSUE SPECIFICITY (ISOFORMS 1; 2 AND 3), SUBCELLULAR LOCATION (ISOFORMS 1; 2 AND 3). |
| [26] | "Assembly and architecture of biogenesis of lysosome-related organelles complex-1 (BLOC-1)." Lee H.H., Nemecek D., Schindler C., Smith W.J., Ghirlando R., Steven A.C., Bonifacino J.S., Hurley J.H. J. Biol. Chem. 287:5882-5890(2012) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION IN THE BLOC-1 COMPLEX, COMPOSITION OF THE BLOC-1 COMPLEX. |
| + | Additional computationally mapped references. |
Web resources
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY265460 mRNA. Translation: AAP91870.1. AF394226 mRNA. Translation: AAL46636.1. AL136637 mRNA. Translation: CAB66572.1. AK054593 mRNA. Translation: BAB70770.1. AK290718 mRNA. Translation: BAF83407.1. AL022343, AL021978 Genomic DNA. Translation: CAI21976.1. AL022343, AL021978 Genomic DNA. Translation: CAI21977.1. AL021978, AL022343 Genomic DNA. Translation: CAI42339.1. AL021978, AL022343 Genomic DNA. Translation: CAI42340.1. BC011912 mRNA. Translation: AAH11912.1. AF061734 mRNA. Translation: AAG43145.1. Different initiation. |
| IPI | IPI00328918. IPI00394984. |
| RefSeq | NP_001258596.1. NM_001271667.1. NP_001258597.1. NM_001271668.1. NP_001258598.1. NM_001271669.1. NP_115498.2. NM_032122.4. NP_898861.1. NM_183040.2. |
| UniGene | Hs.571148. |
3D structure databases | |
| ProteinModelPortal | Q96EV8. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96EV8. 31 interactions. |
| MINT | MINT-1438666. |
| STRING | 9606.ENSP00000341680. |
PTM databases | |
| PhosphoSite | Q96EV8. |
Polymorphism databases | |
| DMDM | 38604971. |
Proteomic databases | |
| PaxDb | Q96EV8. |
| PRIDE | Q96EV8. |
Protocols and materials databases | |
| DNASU | 84062. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000338950; ENSP00000344718; ENSG00000047579. ENST00000344537; ENSP00000341680; ENSG00000047579. |
| GeneID | 84062. |
| KEGG | hsa:84062. |
| UCSC | uc003nbl.3. human. uc003nbp.3. human. |
Organism-specific databases | |
| CTD | 84062. |
| GeneCards | GC06M015470. |
| HGNC | HGNC:17328. DTNBP1. |
| HPA | HPA028053. HPA029615. HPA029616. |
| MIM | 607145. gene. 614076. phenotype. |
| neXtProt | NX_Q96EV8. |
| Orphanet | 231531. Hermansky-Pudlak syndrome type 7. |
| PharmGKB | PA27512. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG81712. |
| HOGENOM | HOG000272621. |
| HOVERGEN | HBG051416. |
| OMA | SAHWEKR. |
| OrthoDB | EOG4FTW21. |
| PhylomeDB | Q96EV8. |
Enzyme and pathway databases | |
| Reactome | REACT_11123. Membrane Trafficking. |
Gene expression databases | |
| ArrayExpress | Q96EV8. |
| Bgee | Q96EV8. |
| CleanEx | HS_DTNBP1. |
| Genevestigator | Q96EV8. |
| GermOnline | ENSG00000047579. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR007531. Dysbindin. [Graphical view] |
| PANTHER | PTHR16294. PTHR16294. 1 hit. |
| Pfam | PF04440. Dysbindin. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84062. |
| NextBio | 73219. |
| SOURCE | Search... |
Entry information
| Entry name | DTBP1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96EV8 Secondary accession number(s): A8K3V3 Q9H3J5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 6 Human chromosome 6: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
