Reviewed,
UniProtKB/Swiss-Prot Q96EQ9 (PRDM9_MOUSE)
Last modified
February 9, 2010.
Version 63.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Histone-lysine N-methyltransferase PRDM9 EC=2.1.1.43 Alternative name(s): PR domain zinc finger protein 9 PR domain-containing protein 9 Meiosis-induced factor containing a PR/SET domain and zinc-finger motif Hybrid sterility protein 1 | ||||
| Gene names |
| ||||
| Organism | Mus musculus (Mouse) | ||||
| Taxonomic identifier | 10090 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Glires › Rodentia › Sciurognathi › Muroidea › Muridae › Murinae › Mus |
Protein attributes
| Sequence length | 843 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Histone methyltransferase that specifically trimethylates 'Lys-4' of histone H3 during meiotic prophase and is essential for proper meiotic progression. Does not have the ability to mono- and dimethylate 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes during early meiotic prophase. Ref.4 |
| Catalytic activity | S-adenosyl-L-methionine + L-lysine-[histone] = S-adenosyl-L-homocysteine + N(6)-methyl-L-lysine-[histone]. |
| Subcellular location | Nucleus Probable. |
| Tissue specificity | Specifically expressed in germ cells entering meiotic prophase in female fetal gonads and in postnatal testis. Ref.4 |
| Developmental stage | Specifically expressed during meiotic prophase. Transiently increases in female gonads from E13.5 to E16.5, the time during which meiosis proceeds from pre-meiotic replication to pachytene stages. Its expression is barely detectable in fetal male gonads. In adults, it is expressed in testis, but not in any other tissue tested. Abundance increases from 10 d post partum (dpp) to 18 dpp, during which time the first wave of spermatogenesis proceeds synchronously from pre-leptotene to pachytene stages. Ref.4 |
| Disruption phenotype | Sterility in both sexes due to severe impairment of the double-stranded break repair pathway, deficient pairing of homologous chromosomes and impaired sex body formation. In testis, H3 'Lys-4' trimethylation is attenuated and meiotic gene transcription is altered. Ref.4 |
| Miscellaneous | Represents a speciation gene in mus genus. Prdm9 is one of several genes responsible for hybrid sterility between M.musculus and house mouse. Hybrid sterility is defined as a situation where parental forms, each fertile inter se, produce infertile offspring. Intersubspecific hybrids of house mouse display spermatogenic failures that are due to variations in the Prdm9 gene. |
| Sequence similarities | Contains 13 C2H2-type zinc fingers. Contains 1 KRAB-related domain. Contains 1 SET domain. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96EQ9-1) Also known as: Meisetz; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96EQ9-2) Also known as: Meisetz-S1; The sequence of this isoform differs from the canonical sequence as follows: 382-404: ELRTEIHPCLLCSLAFSSQKFLT → GGHYYDSLKKKEKREFSLRIFIF 405-843: Missing. | ||||||
| Isoform 3 (identifier: Q96EQ9-3) Also known as: Meisetz-S2; The sequence of this isoform differs from the canonical sequence as follows: 382-418: ELRTEIHPCLLCSLAFSSQKFLTQHMEWNHRTEIFPG → DLFIIICKYTVAVFRHTRRGSQILLRMVVSHHVVAGI 419-843: Missing. | ||||||
| Isoform 4 (identifier: Q96EQ9-4) The sequence of this isoform differs from the canonical sequence as follows: 1-121: Missing. 382-404: ELRTEIHPCLLCSLAFSSQKFLT → GGHYYDSLKKKEKREFSLRIFIF 405-843: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 843 | 843 | Histone-lysine N-methyltransferase PRDM9 | PRO_0000363960 | |||||
Regions | |||||||||
| Domain | 23 – 86 | 64 | KRAB-related | ||||||
| Domain | 246 – 362 | 117 | SET | ||||||
| Zinc finger | 388 – 411 | 24 | C2H2-type 1 | ||||||
| Zinc finger | 513 – 531 | 19 | C2H2-type 2; degenerate | ||||||
| Zinc finger | 537 – 559 | 23 | C2H2-type 3 | ||||||
| Zinc finger | 565 – 587 | 23 | C2H2-type 4 | ||||||
| Zinc finger | 593 – 615 | 23 | C2H2-type 5 | ||||||
| Zinc finger | 621 – 643 | 23 | C2H2-type 6 | ||||||
| Zinc finger | 649 – 671 | 23 | C2H2-type 7 | ||||||
| Zinc finger | 677 – 699 | 23 | C2H2-type 8 | ||||||
| Zinc finger | 705 – 727 | 23 | C2H2-type 9 | ||||||
| Zinc finger | 733 – 755 | 23 | C2H2-type 10 | ||||||
| Zinc finger | 761 – 783 | 23 | C2H2-type 11 | ||||||
| Zinc finger | 789 – 811 | 23 | C2H2-type 12 | ||||||
| Zinc finger | 817 – 839 | 23 | C2H2-type 13 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 121 | 121 | Missing in isoform 4. | VSP_036374 | |||||
| Alternative sequence | 382 – 418 | 37 | ELRTE…EIFPG → DLFIIICKYTVAVFRHTRRG SQILLRMVVSHHVVAGI in isoform 3. | VSP_036375 | |||||
| Alternative sequence | 382 – 404 | 23 | ELRTE…QKFLT → GGHYYDSLKKKEKREFSLRI FIF in isoform 2 and isoform 4. | VSP_036376 | |||||
| Alternative sequence | 405 – 843 | 439 | Missing in isoform 2 and isoform 4. | VSP_036377 | |||||
| Alternative sequence | 419 – 843 | 425 | Missing in isoform 3. | VSP_036378 | |||||
Experimental info | |||||||||
| Mutagenesis | 276 | 1 | Y → F: Abolishes enzyme methyltransferase. Ref.4 | ||||||
| Mutagenesis | 278 | 1 | G → A: Abolishes enzyme methyltransferase. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Genomic sequence analysis in the mouse T-complex region." Brathwaite M., Waeltz P., Nagaraja R. Submitted (MAY-2003) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [2] | "Lineage-specific biology revealed by a finished genome assembly of the mouse." Church D.M., Goodstadt L., Hillier L.W., Zody M.C., Goldstein S., She X., Bult C.J., Agarwala R., Cherry J.L., DiCuccio M., Hlavina W., Kapustin Y., Meric P., Maglott D., Birtle Z., Marques A.C., Graves T., Zhou S. Ponting C.P.PLoS Biol. 7:E1000112-E1000112(2009) [PubMed: 19468303] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. Strain: C57BL/6J. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4). Tissue: Eye. |
| [4] | "A histone H3 methyltransferase controls epigenetic events required for meiotic prophase." Hayashi K., Yoshida K., Matsui Y. Nature 438:374-378(2005) [PubMed: 16292313] [Abstract] Cited for: FUNCTION, CATALYTIC ACTIVITY, ALTERNATIVE SPLICING (ISOFORMS 1; 2 AND 3), TISSUE SPECIFICITY, DEVELOPMENTAL STAGE, DISRUPTION PHENOTYPE, MUTAGENESIS OF TYR-276 AND GLY-278. |
| [5] | "A mouse speciation gene encodes a meiotic histone H3 methyltransferase." Mihola O., Trachtulec Z., Vlcek C., Schimenti J.C., Forejt J. Science 323:373-375(2009) [PubMed: 19074312] [Abstract] Cited for: IDENTIFICATION AS A SPECIATION GENE. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY294423 Genomic DNA. Translation: AAQ01511.1. AC154378 Genomic DNA. No translation available. CT033750 Genomic DNA. Translation: CAX15894.1. BC012016 mRNA. Translation: AAH12016.1. BC049903 mRNA. Translation: AAH49903.1. Different initiation. |
| IPI | IPI00808336. IPI00850969. IPI00921630. IPI00921635. |
| RefSeq | XP_619431.3. |
| UniGene | Mm.215162 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96EQ9. |
Proteomic databases | |
| PRIDE | Q96EQ9. |
Genome annotation databases | |
| Ensembl | ENSMUST00000038416; ENSMUSP00000040727; ENSMUSG00000051977; Mus musculus. [Genome view] |
| GeneID | 213389. |
| UCSC | uc008aos.1. mouse. |
Organism-specific databases | |
| CTD | 213389. |
| MGI | MGI:2384854. Prdm9. |
Phylogenomic databases | |
| eggNOG | roNOG16471. |
| HOVERGEN | Q96EQ9. |
Gene expression databases | |
| ArrayExpress | Q96EQ9. |
| Bgee | Q96EQ9. |
| Genevestigator | Q96EQ9. |
Family and domain databases | |
| InterPro | IPR001909. Krueppel-associated_box. IPR003655. Krueppel-associated_box-rel. IPR001214. SET_dom. IPR019041. SSXRD_motif. IPR007087. Znf_C2H2. IPR015880. Znf_C2H2-like. IPR013087. Znf_C2H2/integrase_DNA-bd. [Graphical view] |
| Gene3D | G3DSA:3.30.160.60. Znf_C2H2/integrase_DNA-bd. 11 hits. |
| Pfam | PF01352. KRAB. 1 hit. PF09514. SSXRD. 1 hit. PF00096. zf-C2H2. 11 hits. [Graphical view] |
| SMART | SM00349. KRAB. 1 hit. SM00317. SET. 1 hit. SM00355. ZnF_C2H2. 13 hits. [Graphical view] |
| PROSITE | PS50806. KRAB_RELATED. 1 hit. PS50280. SET. 1 hit. PS00028. ZINC_FINGER_C2H2_1. 12 hits. PS50157. ZINC_FINGER_C2H2_2. 12 hits. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | PRDM9_MOUSE | ||||||||
| Accession | Primary (citable) accession number: Q96EQ9 Secondary accession number(s): B8JJZ8, Q0D2N4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| MGD cross-references Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


