Q96EP1 (CHFR_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 103.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase CHFR EC=6.3.2.- Alternative name(s): Checkpoint with forkhead and RING finger domains protein RING finger protein 196 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 664 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase that functions in the antephase checkpoint by actively delaying passage into mitosis in response to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably involved in signaling the presence of mitotic stress caused by microtubule poisons by mediating the 'Lys-48'-linked ubiquitination of target proteins, leading to their degradation by the proteasome. Promotes the ubiquitination and subsequent degradation of AURKA and PLK1. Probably acts as a tumor suppressor, possibly by mediating the polyubiquitination of HDAC1, leading to its degradation. May also promote the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. Ref.1 Ref.6 Ref.7 Ref.13 Ref.14 Ref.16 Ref.18 |
| Pathway | |
| Subunit structure | Interacts with HDAC1 and HDAC2. Interacts with PML (with sumoylated form of PML). Ref.13 Ref.15 Ref.18 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.1 |
| Developmental stage | Weakly expressed in G1 phase, and highly expressed during S phase. Ref.7 |
| Domain | The PBZ-type zinc finger (also named CYR) mediates non-covalent poly(ADP-ribose)-binding. Poly(ADP-ribose)-binding is dependent on the presence of zinc and is required for its function in antephase checkpoint. Ref.16 Ref.17 The FHA domain plays a key role in the anti-proliferative properties of the protein and is involved in initiating a cell cycle arrest at G2/M. The FHA domain may be required to interact with phosphorylated proteins. Ref.16 Ref.17 |
| Post-translational modification | Poly-ADP-ribosylated. In addition to binding non covalently poly(ADP-ribose) via its PBZ-type zinc finger, the protein is also covalently poly-ADP-ribosylated by PARP1. Ref.16 Autoubiquitinated; may regulate its cellular level. Phosphorylated upon DNA damage, probably by ATM or ATR By similarity. Phosphorylated by PKB. Phosphorylation may affect its E3 ligase activity. Ref.12 Ref.13 |
| Miscellaneous | CHFR is silenced in many primary cancers because of CpG methylation and deacetylated histones on its promoter region. This however raises the question of whether CHFR silencing is a consequence or a cause of primary cancers. |
| Sequence similarities | Belongs to the CHFR family. Contains 1 FHA domain. Contains 1 PBZ-type zinc finger. Contains 1 RING-type zinc finger. |
Ontologies
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96EP1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96EP1-2) The sequence of this isoform differs from the canonical sequence as follows: 135-146: Missing. | ||||||
| Isoform 3 (identifier: Q96EP1-3) The sequence of this isoform differs from the canonical sequence as follows: 136-206: ANKENVFHGT...PAGRERSSSC → MVPCCVAQAGLKLLGSSDPPTLASQSIVIT | ||||||
| Isoform 4 (identifier: Q96EP1-4) The sequence of this isoform differs from the canonical sequence as follows: 470-470: Missing. | ||||||
| Isoform 5 (identifier: Q96EP1-5) The sequence of this isoform differs from the canonical sequence as follows: 115-207: NVAYLYESLS...AGRERSSSCG → R | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 664 | 664 | E3 ubiquitin-protein ligase CHFR | PRO_0000055872 | |||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||
| Domain | 38 – 89 | 52 | FHA | ||||||||||||||||||||||||||||||||||
| Zinc finger | 304 – 343 | 40 | RING-type | ||||||||||||||||||||||||||||||||||
| Zinc finger | 633 – 655 | 23 | PBZ-type | ||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||
| Modified residue | 130 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||
| Modified residue | 386 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 115 – 207 | 93 | NVAYL…SSSCG → R in isoform 5. | VSP_038126 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 135 – 146 | 12 | Missing in isoform 2. | VSP_009349 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 136 – 206 | 71 | ANKEN…RSSSC → MVPCCVAQAGLKLLGSSDPP TLASQSIVIT in isoform 3. | VSP_009350 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 470 | 1 | Missing in isoform 4. | VSP_038127 | |||||||||||||||||||||||||||||||||
| Natural variant | 166 | 1 | P → L in a patient with non small cell lung carcinomas; homozygous. Ref.20 | VAR_017582 | |||||||||||||||||||||||||||||||||
| Natural variant | 202 | 1 | R → P in a patient with non small cell lung carcinomas. Ref.20 | VAR_017583 | |||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | G → R. Ref.8 | VAR_017584 | |||||||||||||||||||||||||||||||||
| Natural variant | 497 | 1 | A → V Common polymorphism. Ref.4 Ref.8 Corresponds to variant rs2306541 [ dbSNP | Ensembl ]. | VAR_017585 | |||||||||||||||||||||||||||||||||
| Natural variant | 536 | 1 | F → S in a patient with non small cell lung carcinomas. Ref.20 | VAR_017586 | |||||||||||||||||||||||||||||||||
| Natural variant | 580 | 1 | V → M Common polymorphism. Ref.1 Ref.2 Ref.8 Corresponds to variant rs2306536 [ dbSNP | Ensembl ]. | VAR_017587 | |||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 39 | 1 | T → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-205. Ref.12 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 205 | 1 | S → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-39. Ref.12 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 306 | 1 | I → A: Abolishes autoubiquitination. Does not affect phosphorylation. Ref.6 Ref.18 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 332 | 1 | W → A: Abolishes autoubiquitination in vitro. Ref.6 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 632 | 1 | R → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. Ref.16 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 635 | 1 | C → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1; when associated with A-641. Ref.16 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 641 | 1 | C → A: Abolishes poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1; when associated with A-635. Ref.16 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 642 | 1 | R → A: Impairs poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. Ref.16 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 644 | 1 | Q → A: Impairs poly(ADP-ribose)-binding and poly-ADP-ribosylation by PARP1. Ref.16 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 256 | 1 | V → E in BAA91817. Ref.2 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 462 | 1 | S → P in BAA91817. Ref.2 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 599 | 1 | V → A in BAG65178. Ref.2 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 617 | 1 | R → Q in BAA91817. Ref.2 | ||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 21 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 26 – 28 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 35 – 43 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 46 – 49 | 4 | |||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 65 | 5 | |||||||||||||||||||||||||||||||||||
| Turn | 67 – 69 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 76 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 78 – 80 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 82 – 90 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 97 | 6 | |||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 106 | 5 | |||||||||||||||||||||||||||||||||||
| Helix | 112 – 114 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 123 | 8 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Chfr defines a mitotic stress checkpoint that delays entry into metaphase." Scolnick D.M., Halazonetis T.D. Nature 406:430-435(2000) [PubMed: 10935642] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT MET-580. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2; 3 AND 4), VARIANT MET-580. Tissue: Teratocarcinoma, Testis and Trachea. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-497. Tissue: Placenta. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 359-664. Tissue: Testis. |
| [6] | "The checkpoint protein Chfr is a ligase that ubiquitinates Plk1 and inhibits Cdc2 at the G2 to M transition." Kang D., Chen J., Wong J., Fang G. J. Cell Biol. 156:249-259(2002) [PubMed: 11807090] [Abstract] Cited for: FUNCTION, AUTOUBIQUITINATION, MUTAGENESIS OF ILE-306 AND TRP-332. |
| [7] | "Chfr regulates a mitotic stress pathway through its RING-finger domain with ubiquitin ligase activity." Chaturvedi P., Sudakin V., Bobiak M.L., Fisher P.W., Mattern M.R., Jablonski S.A., Hurle M.R., Zhu Y., Yen T.J., Zhou B.-B. Cancer Res. 62:1797-1801(2002) [PubMed: 11912157] [Abstract] Cited for: FUNCTION, AUTOUBIQUITINATION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE. |
| [8] | "Aberrant hypermethylation of the CHFR prophase checkpoint gene in human lung cancers." Mizuno K., Osada H., Konishi H., Tatematsu Y., Yatabe Y., Mitsudomi T., Fujii Y., Takahashi T. Oncogene 21:2328-2333(2002) [PubMed: 11948416] [Abstract] Cited for: VARIANTS ARG-270; VAL-497 AND MET-580, SILENCING IN PRIMARY CANCERS. |
| [9] | "Frequent hypermethylation of the 5' CpG island of the mitotic stress checkpoint gene Chfr in colorectal and non-small cell lung cancer." Corn P.G., Summers M.K., Fogt F., Virmani A.K., Gazdar A.F., Halazonetis T.D., El-Deiry W.S. Carcinogenesis 24:47-51(2003) [PubMed: 12538348] [Abstract] Cited for: SILENCING IN PRIMARY CANCERS. |
| [10] | "Epigenetic inactivation of CHFR in human tumors." Toyota M., Sasaki Y., Satoh A., Ogi K., Kikuchi T., Suzuki H., Mita H., Tanaka N., Itoh F., Issa J.-P.J., Jair K.-W., Schuebel K.E., Imai K., Tokino T. Proc. Natl. Acad. Sci. U.S.A. 100:7818-7823(2003) [PubMed: 12810945] [Abstract] Cited for: SILENCING IN PRIMARY CANCERS. |
| [11] | "Epigenetic inactivation of CHFR and sensitivity to microtubule inhibitors in gastric cancer." Satoh A., Toyota M., Itoh F., Sasaki Y., Suzuki H., Ogi K., Kikuchi T., Mita H., Yamashita T., Kojima T., Kusano M., Fujita M., Hosokawa M., Endo T., Tokino T., Imai K. Cancer Res. 63:8606-8613(2003) [PubMed: 14695171] [Abstract] Cited for: SILENCING IN PRIMARY CANCERS. |
| [12] | "Promotion of mitosis by activated protein kinase B after DNA damage involves polo-like kinase 1 and checkpoint protein CHFR." Shtivelman E. Mol. Cancer Res. 1:959-969(2003) [PubMed: 14638868] [Abstract] Cited for: PHOSPHORYLATION, MUTAGENESIS OF THR-39 AND SER-205. |
| [13] | "The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains." Bothos J., Summers M.K., Venere M., Scolnick D.M., Halazonetis T.D. Oncogene 22:7101-7107(2003) [PubMed: 14562038] [Abstract] Cited for: FUNCTION, INTERACTION WITH UBE2V2, PHOSPHORYLATION. |
| [14] | "CHFR-associated early G2/M checkpoint defects in breast cancer cells." Erson A.E., Petty E.M. Mol. Carcinog. 39:26-33(2004) [PubMed: 14694445] [Abstract] Cited for: FUNCTION. |
| [15] | "PML bodies control the nuclear dynamics and function of the CHFR mitotic checkpoint protein." Daniels M.J., Marson A., Venkitaraman A.R. Nat. Struct. Mol. Biol. 11:1114-1121(2004) [PubMed: 15467728] [Abstract] Cited for: SUBCELLULAR LOCATION, INTERACTION WITH PML. |
| [16] | "Poly(ADP-ribose)-binding zinc finger motifs in DNA repair/checkpoint proteins." Ahel I., Ahel D., Matsusaka T., Clark A.J., Pines J., Boulton S.J., West S.C. Nature 451:81-85(2008) [PubMed: 18172500] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, DOMAIN PBZ-TYPE, POLY-ADP-RIBOSYLATION, ADP-RIBOSE-BINDING, MUTAGENESIS OF ARG-632; CYS-635; CYS-641; ARG-642 AND GLN-644. |
| [17] | "The anti-proliferative effects of the CHFR depend on the forkhead associated domain, but not E3 ligase activity mediated by ring finger domain." Fukuda T., Kondo Y., Nakagama H. PLoS ONE 3:E1776-E1776(2008) [PubMed: 18335050] [Abstract] Cited for: DOMAIN FHA. |
| [18] | "Chfr is linked to tumour metastasis through the downregulation of HDAC1." Oh Y.M., Kwon Y.E., Kim J.M., Bae S.J., Lee B.K., Yoo S.J., Chung C.H., Deshaies R.J., Seol J.H. Nat. Cell Biol. 11:295-302(2009) [PubMed: 19182791] [Abstract] Cited for: FUNCTION, INTERACTION WITH HDAC1 AND HDAC2, AUTOUBIQUITINATION, MUTAGENESIS OF ILE-306. |
| [19] | "Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein and its complex with tungstate." Stavridi E.S., Huyen Y., Loreto I.R., Scolnick D.M., Halazonetis T.D., Pavletich N.P., Jeffrey P.D. Structure 10:891-899(2002) [PubMed: 12121644] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 14-128. |
| [20] | "Inactivating mutations targeting the chfr mitotic checkpoint gene in human lung cancer." Mariatos G., Bothos J., Zacharatos P., Summers M.K., Scolnick D.M., Kittas C., Halazonetis T.D., Gorgoulis V.G. Cancer Res. 63:7185-7189(2003) [PubMed: 14612512] [Abstract] Cited for: VARIANTS LEU-166; PRO-202 AND SER-536. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF170724 mRNA. Translation: AAF91084.1. AK001658 mRNA. Translation: BAA91817.1. AK027687 mRNA. Translation: BAB55297.1. AK302785 mRNA. Translation: BAG63989.1. AK304333 mRNA. Translation: BAG65178.1. AC127070 Genomic DNA. No translation available. BC012072 mRNA. Translation: AAH12072.1. AL137561 mRNA. Translation: CAB70812.1. | ||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00023513. IPI00397548. IPI00796680. IPI00930659. IPI00953641. | ||||||||||||||||||||||||||||||||||||||||||
| PIR | T46399. | ||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001154816.1. NM_001161344.1. NP_001154817.1. NM_001161345.1. NP_001154818.1. NM_001161346.1. NP_001154819.1. NM_001161347.1. NP_060693.2. NM_018223.2. | ||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.720197. | ||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| SMR | Q96EP1. Positions 14-125, 294-369, 424-663. | ||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q96EP1. 15 interactions. | ||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-1381330. | ||||||||||||||||||||||||||||||||||||||||||
| STRING | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||
| DMDM | 41688511. | ||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000266880; ENSP00000266880; ENSG00000072609. ENST00000443047; ENSP00000416431; ENSG00000072609. | ||||||||||||||||||||||||||||||||||||||||||
| GeneID | 55743. | ||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:55743. | ||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001uld.1. human. uc001ule.1. human. uc001ulf.1. human. | ||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||
| CTD | 55743. | ||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC12M133416. | ||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:20455. CHFR. | ||||||||||||||||||||||||||||||||||||||||||
| MIM | 605209. gene. | ||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA134898949. | ||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||
| eggNOG | prNOG15533. | ||||||||||||||||||||||||||||||||||||||||||
| GeneTree | ENSGT00400000022306. | ||||||||||||||||||||||||||||||||||||||||||
| HOGENOM | HBG446387. | ||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG048005. | ||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| OMA | DVIYVVY. | ||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG43FGWJ. | ||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| CleanEx | HS_CHFR. | ||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q96EP1. | ||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000072609. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR000253. FHA_dom. IPR008984. SMAD_FHA_domain. IPR018957. Znf_C3HC4_RING-type. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| Gene3D | G3DSA:2.60.200.20. FHA. 1 hit. G3DSA:3.30.40.10. Znf_RING/FYVE/PHD. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| KO | K10644. | ||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00498. FHA. 1 hit. PF00097. zf-C3HC4. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00240. FHA. 1 hit. SM00184. RING. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF49879. SMAD_FHA. 1 hit. | ||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50006. FHA_DOMAIN. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||
| NextBio | 60707. | ||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | CHFR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96EP1 Secondary accession number(s): A6NEN5 Q9NVD5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with