Reviewed,
UniProtKB/Swiss-Prot Q96EP1 (CHFR_HUMAN)
Last modified
June 16, 2009.
Version 76.
History...
Clusters with 100%,
90%,
50% identity |
Documents (7) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: E3 ubiquitin-protein ligase CHFR EC=6.3.2.- Alternative name(s): Checkpoint with forkhead and RING finger domains protein RING finger protein 196 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 664 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase required to transiently arrest cells in early prophase when they are exposed to microtubule poisons. Acts in early prophase before chromosome condensation, when the centrosome move apart from each other along the periphery of the nucleus. Probably promotes the formation of 'Lys-63'-linked polyubiquitin chains and functions with the specific ubiquitin-conjugating UBC13-MMS2 (UBE2N-UBE2V2) heterodimer. Substrates that are polyubiquitinated at 'Lys-63' are usually not targeted for degradation, but are rather involved in signaling cellular stress. This suggests that it may be involved in signaling the presence of mitotic stress caused by microtubule poisons. Ref.1 Ref.6 Ref.7 Ref.14 Ref.15 |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Ref.1 |
| Developmental stage | Weakly expressed in G1 phase, and highly expressed during S phase. Ref.7 |
| Domain | The FHA domain may be required to interact with phosphorylated proteins. |
| Post-translational modification | Autoubiquitinated in vitro. Phosphorylated upon DNA damage, probably by ATM or ATR By similarity. Phosphorylated by PKB. Phosphorylation may affect its E3 ligase activity. |
| Involvement in disease | Defects in CHFR may be involved in colon, lung and esophageal cancers and non small cell lung carcinomas (NSCLC). In addition, CHFR gene is silenced in many primary cancers because of CpG methylation and deacetylated histones on its promoter region. This however raises the question of whether CHFR silencing is a consequence or a cause of primary cancers. Ref.8 Ref.9 Ref.10 Ref.11 Ref.12 |
| Sequence similarities | Contains 1 FHA domain. Contains 1 RING-type zinc finger. |
| Caution | Ref.6 and Ref.7 report that it can ubiquitinate and promote the degradation of substrates. Ref.6 reports that, in Xenopus extracts, it ubiquitinates PLK, a protein kinase involved in mitotic progression. However, as experiments have been done either in vitro or with extracts from Xenopus, there is actually little evidence for a role for CHFR in protein degradation in vivo. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96EP1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96EP1-2) The sequence of this isoform differs from the canonical sequence as follows: 135-146: Missing. | ||||||
| Isoform 3 (identifier: Q96EP1-3) The sequence of this isoform differs from the canonical sequence as follows: 136-206: ANKENVFHGT...PAGRERSSSC → EMVPCCVAQAGLKLLGSSDPPTLASQSIVIT | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 664 | 664 | E3 ubiquitin-protein ligase CHFR | PRO_0000055872 | |||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||
| Domain | 38 – 89 | 52 | FHA | ||||||||||||||||||||||||||||||||||
| Zinc finger | 304 – 343 | 40 | RING-type | ||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||
| Modified residue | 130 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||
| Modified residue | 386 | 1 | Phosphothreonine By similarity | ||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 135 – 146 | 12 | Missing in isoform 2. | VSP_009349 | |||||||||||||||||||||||||||||||||
| Alternative sequence | 136 – 206 | 71 | ANKEN…RSSSC → EMVPCCVAQAGLKLLGSSDP PTLASQSIVIT in isoform 3. | VSP_009350 | |||||||||||||||||||||||||||||||||
| Natural variant | 166 | 1 | P → L in a patient with NSCLC; homozygous. Ref.12 | VAR_017582 | |||||||||||||||||||||||||||||||||
| Natural variant | 202 | 1 | R → P in a patient with NSCLC. Ref.12 | VAR_017583 | |||||||||||||||||||||||||||||||||
| Natural variant | 270 | 1 | G → R Ref.8 | VAR_017584 | |||||||||||||||||||||||||||||||||
| Natural variant | 456 | 1 | A → V: dbSNP rs2306541. | VAR_038192 | |||||||||||||||||||||||||||||||||
| Natural variant | 497 | 1 | A → V Common polymorphism. dbSNP rs2306541. Ref.8 Ref.4 | VAR_017585 | |||||||||||||||||||||||||||||||||
| Natural variant | 536 | 1 | F → S in a patient with NSCLC. Ref.12 | VAR_017586 | |||||||||||||||||||||||||||||||||
| Natural variant | 580 | 1 | V → M Common polymorphism. dbSNP rs2306536. Ref.1 Ref.8 | VAR_017587 | |||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||
| Mutagenesis | 39 | 1 | T → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-205. Ref.13 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 205 | 1 | S → A: Abolishes phosphorylation but not autoubiquitination; when associated with A-39. Ref.13 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 306 | 1 | I → A: Abolishes autoubiquitination in vitro. Does not affect phosphorylation. Ref.6 | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 332 | 1 | W → A: Abolishes autoubiquitination in vitro. Ref.6 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 256 | 1 | V → E in BAA91817. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 462 | 1 | S → P in BAA91817. Ref.4 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 617 | 1 | R → Q in BAA91817. Ref.4 | ||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Beta strand | 17 – 21 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 26 – 28 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 35 – 43 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 46 – 49 | 4 | |||||||||||||||||||||||||||||||||||
| Beta strand | 61 – 65 | 5 | |||||||||||||||||||||||||||||||||||
| Turn | 67 – 69 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 72 – 76 | 5 | |||||||||||||||||||||||||||||||||||
| Beta strand | 78 – 80 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 82 – 90 | 9 | |||||||||||||||||||||||||||||||||||
| Beta strand | 92 – 97 | 6 | |||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 106 | 5 | |||||||||||||||||||||||||||||||||||
| Helix | 112 – 114 | 3 | |||||||||||||||||||||||||||||||||||
| Beta strand | 116 – 123 | 8 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Chfr defines a mitotic stress checkpoint that delays entry into metaphase." Scolnick D.M., Halazonetis T.D. Nature 406:430-435(2000) [PubMed: 10935642] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT MET-580. |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed: 14702039] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Teratocarcinoma. |
| [3] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed: 16541075] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), VARIANT VAL-497. Tissue: Placenta. |
| [5] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Blocker H., Heubner D., Hoerlein A., Michel G., Wedler H., Kohrer K., Ottenwalder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed: 17974005] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 359-664. Tissue: Testis. |
| [6] | "The checkpoint protein Chfr is a ligase that ubiquitinates Plk1 and inhibits Cdc2 at the G2 to M transition." Kang D., Chen J., Wong J., Fang G. J. Cell Biol. 156:249-259(2002) [PubMed: 11807090] [Abstract] Cited for: FUNCTION, AUTOUBIQUITINATION, MUTAGENESIS OF ILE-306 AND TRP-332. |
| [7] | "Chfr regulates a mitotic stress pathway through its RING-finger domain with ubiquitin ligase activity." Chaturvedi P., Sudakin V., Bobiak M.L., Fisher P.W., Mattern M.R., Jablonski S.A., Hurle M.R., Zhu Y., Yen T.J., Zhou B.-B. Cancer Res. 62:1797-1801(2002) [PubMed: 11912157] [Abstract] Cited for: FUNCTION, AUTOUBIQUITINATION, SUBCELLULAR LOCATION, DEVELOPMENTAL STAGE. |
| [8] | "Aberrant hypermethylation of the CHFR prophase checkpoint gene in human lung cancers." Mizuno K., Osada H., Konishi H., Tatematsu Y., Yatabe Y., Mitsudomi T., Fujii Y., Takahashi T. Oncogene 21:2328-2333(2002) [PubMed: 11948416] [Abstract] Cited for: DISEASE, VARIANTS ARG-270; VAL-497 AND MET-580. |
| [9] | "Frequent hypermethylation of the 5' CpG island of the mitotic stress checkpoint gene Chfr in colorectal and non-small cell lung cancer." Corn P.G., Summers M.K., Fogt F., Virmani A.K., Gazdar A.F., Halazonetis T.D., El-Deiry W.S. Carcinogenesis 24:47-51(2003) [PubMed: 12538348] [Abstract] Cited for: DISEASE. |
| [10] | "Epigenetic inactivation of CHFR in human tumors." Toyota M., Sasaki Y., Satoh A., Ogi K., Kikuchi T., Suzuki H., Mita H., Tanaka N., Itoh F., Issa J.-P.J., Jair K.-W., Schuebel K.E., Imai K., Tokino T. Proc. Natl. Acad. Sci. U.S.A. 100:7818-7823(2003) [PubMed: 12810945] [Abstract] Cited for: DISEASE. |
| [11] | "Epigenetic inactivation of CHFR and sensitivity to microtubule inhibitors in gastric cancer." Satoh A., Toyota M., Itoh F., Sasaki Y., Suzuki H., Ogi K., Kikuchi T., Mita H., Yamashita T., Kojima T., Kusano M., Fujita M., Hosokawa M., Endo T., Tokino T., Imai K. Cancer Res. 63:8606-8613(2003) [PubMed: 14695171] [Abstract] Cited for: DISEASE. |
| [12] | "Inactivating mutations targeting the chfr mitotic checkpoint gene in human lung cancer." Mariatos G., Bothos J., Zacharatos P., Summers M.K., Scolnick D.M., Kittas C., Halazonetis T.D., Gorgoulis V.G. Cancer Res. 63:7185-7189(2003) [PubMed: 14612512] [Abstract] Cited for: VARIANTS NSCLC LEU-166; PRO-202 AND SER-536. |
| [13] | "Promotion of mitosis by activated protein kinase B after DNA damage involves polo-like kinase 1 and checkpoint protein CHFR." Shtivelman E. Mol. Cancer Res. 1:959-969(2003) [PubMed: 14638868] [Abstract] Cited for: PHOSPHORYLATION, MUTAGENESIS OF THR-39 AND SER-205. |
| [14] | "The Chfr mitotic checkpoint protein functions with Ubc13-Mms2 to form Lys63-linked polyubiquitin chains." Bothos J., Summers M.K., Venere M., Scolnick D.M., Halazonetis T.D. Oncogene 22:7101-7107(2003) [PubMed: 14562038] [Abstract] Cited for: FUNCTION, INTERACTION WITH UBE2V2, PHOSPHORYLATION. |
| [15] | "CHFR-associated early G2/M checkpoint defects in breast cancer cells." Erson A.E., Petty E.M. Mol. Carcinog. 39:26-33(2004) [PubMed: 14694445] [Abstract] Cited for: FUNCTION. |
| [16] | "Crystal structure of the FHA domain of the Chfr mitotic checkpoint protein and its complex with tungstate." Stavridi E.S., Huyen Y., Loreto I.R., Scolnick D.M., Halazonetis T.D., Pavletich N.P., Jeffrey P.D. Structure 10:891-899(2002) [PubMed: 12121644] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 14-128. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AF170724 mRNA. Translation: AAF91084.1. AK001658 mRNA. Translation: BAA91817.1. AK027687 mRNA. Translation: BAB55297.1. AC127070 Genomic DNA. No translation available. BC012072 mRNA. Translation: AAH12072.1. AL137561 mRNA. Translation: CAB70812.1. | |||||||||||||||||||
| IPI | IPI00023513. IPI00397548. IPI00397549. | ||||||||||||||||||
| PIR | T46399. | ||||||||||||||||||
| RefSeq | NP_060693.1. | ||||||||||||||||||
| UniGene | Hs.656770 | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| |||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q96EP1. 6 interactions. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PRIDE | Q96EP1. | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENSG00000072609. Homo sapiens. [Contig view] | ||||||||||||||||||
| GeneID | 55743. | ||||||||||||||||||
| KEGG | hsa:55743. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| GeneCards | GC12M131927. | ||||||||||||||||||
| H-InvDB | HIX0011141. | ||||||||||||||||||
| HGNC | HGNC:20455. CHFR. | ||||||||||||||||||
| MIM | 605209. gene. | ||||||||||||||||||
| PharmGKB | PA134898949. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| HOGENOM | Q96EP1. | ||||||||||||||||||
| HOVERGEN | Q96EP1. | ||||||||||||||||||
| OMA | Q96EP1. TLEDTST. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q96EP1. | ||||||||||||||||||
| Bgee | Q96EP1. | ||||||||||||||||||
| CleanEx | HS_CHFR. | ||||||||||||||||||
| GermOnline | ENSG00000072609. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| InterPro | IPR000253. FHA. IPR018957. Znf_C3HC4_RING-type. IPR001841. Znf_RING. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||||||||
| Gene3D | G3DSA:2.60.200.20. FHA. 1 hit. | ||||||||||||||||||
| Pfam | PF00498. FHA. 1 hit. PF00097. zf-C3HC4. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00240. FHA. 1 hit. SM00184. RING. 1 hit. [Graphical view] | ||||||||||||||||||
| PROSITE | PS50006. FHA_DOMAIN. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other Resources | |||||||||||||||||||
| NextBio | 60707. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | CHFR_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96EP1 Secondary accession number(s): A6NEN5 Q9NVD5 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


