Q96EE3 (SEH1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Nucleoporin SEH1 Alternative name(s): Nup107-160 subcomplex subunit SEH1 SEC13-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 360 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex is required for the assembly of a functional NPC. The Nup107-160 subcomplex is also required for normal kinetochore microtubule attachment, mitotic progression and chromosome segregation. This subunit plays a role in recruitment of the Nup107-160 subcomplex to the kinetochore. Ref.6 Ref.7 |
| Subunit structure | Component of the Nup107-160 subcomplex of the nuclear pore complex (NPC). The Nup107-160 subcomplex includes NUP160, NUP133, NUP107, NUP98, NUP85, NUP43, NUP37, SEH1 and SEC13. The SEH1 subunit appears to be only weakly associated with the Nup107-160 subcomplex. Ref.8 |
| Subcellular location | Chromosome › centromere › kinetochore. Nucleus › nuclear pore complex Ref.6 Ref.7. |
| Sequence similarities | Belongs to the WD repeat SEC13 family. Contains 6 WD repeats. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform A (identifier: Q96EE3-2) Also known as: SEH1A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform B (identifier: Q96EE3-1) Also known as: SEH1B; The sequence of this isoform differs from the canonical sequence as follows: 358-360: KHS → YFFTPLDSPRAGSRWSSYAQLLPPPPPPLVEHSCDADTANLQYPHPRRRYLSRPLNPLPENEGI | ||||||
| Note: Contains a phosphoserine at position 365. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 360 | 360 | Nucleoporin SEH1 | PRO_0000051213 | |||||
Regions | |||||||||
| Repeat | 10 – 49 | 40 | WD 1 | ||||||
| Repeat | 55 – 96 | 42 | WD 2 | ||||||
| Repeat | 111 – 152 | 42 | WD 3 | ||||||
| Repeat | 160 – 210 | 51 | WD 4 | ||||||
| Repeat | 217 – 258 | 42 | WD 5 | ||||||
| Repeat | 276 – 315 | 40 | WD 6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 358 – 360 | 3 | KHS → YFFTPLDSPRAGSRWSSYAQ LLPPPPPPLVEHSCDADTAN LQYPHPRRRYLSRPLNPLPE NEGI in isoform B. | VSP_037954 | |||||
| Natural variant | 342 | 1 | T → N. Ref.3 Ref.4 Corresponds to variant rs6505776 [ dbSNP | Ensembl ]. | VAR_053417 | |||||
Experimental info | |||||||||
| Sequence conflict | 78 | 1 | S → P in BAB71317. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "cDNA cloning of a human homolog of yeast SEH1 gene." Pan H., Yu Y., Shen L., Huo K.-K., Li Y.-Y. Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS A AND B). Tissue: Liver. |
| [2] | "Proteomic analysis of the mammalian nuclear pore complex." Cronshaw J.M., Krutchinsky A.N., Zhang W., Chait B.T., Matunis M.J. J. Cell Biol. 158:915-927(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A). |
| [3] | "A novel gene expressed in human adrenal gland." Li Y., Gu Y., Peng Y., Fu S., Gu J., Zhang L., Jiang C., Yu Y., Han Z., Wang Y., Chen Z., Fu G. Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM A), VARIANT ASN-342. Tissue: Adrenal gland. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM B), VARIANT ASN-342. Tissue: Skeletal muscle. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM A). Tissue: Eye. |
| [6] | "The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis." Loieodice I., Alves A., Rabut G., Van Overbeek M., Ellenberg J., Sibarita J.-B., Doye V. Mol. Biol. Cell 15:3333-3344(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, ASSOCIATION WITH THE NUP107-160 COMPLEX, SUBCELLULAR LOCATION. |
| [7] | "The human Nup107-160 nuclear pore subcomplex contributes to proper kinetochore functions." Zuccolo M., Alves A., Galy V., Bolhy S., Formstecher E., Racine V., Sibarita J.-B., Fukagawa T., Shiekhattar R., Yen T., Doye V. EMBO J. 26:1853-1864(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [8] | "Cell-cycle-dependent phosphorylation of the nuclear pore Nup107-160 subcomplex." Glavy J.S., Krutchinsky A.N., Cristea I.M., Berke I.C., Boehmer T., Blobel G., Chait B.T. Proc. Natl. Acad. Sci. U.S.A. 104:3811-3816(2007) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE NUP107-160 COMPLEX. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-365 (ISOFORM B), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF255625 mRNA. Translation: AAM21169.1. AF431970 mRNA. Translation: AAM44214.1. AF514996 mRNA. Translation: AAM76707.1. AF136976 mRNA. Translation: AAG49437.1. AK056940 mRNA. Translation: BAB71317.1. AK291226 mRNA. Translation: BAF83915.1. BC012430 mRNA. Translation: AAH12430.1. |
| IPI | IPI00185533. IPI00220609. |
| RefSeq | NP_001013455.1. NM_001013437.1. NP_112493.2. NM_031216.3. |
| UniGene | Hs.301048. |
3D structure databases | |
| ProteinModelPortal | Q96EE3. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96EE3. 9 interactions. |
| STRING | 9606.ENSP00000382779. |
Polymorphism databases | |
| DMDM | 257051064. |
Proteomic databases | |
| PaxDb | Q96EE3. |
| PRIDE | Q96EE3. |
Protocols and materials databases | |
| DNASU | 81929. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000262124; ENSP00000262124; ENSG00000085415. ENST00000399892; ENSP00000382779; ENSG00000085415. |
| GeneID | 81929. |
| KEGG | hsa:81929. |
| UCSC | uc002krq.3. human. uc002krr.3. human. |
Organism-specific databases | |
| CTD | 81929. |
| GeneCards | GC18P012947. |
| HGNC | HGNC:30379. SEH1L. |
| HPA | HPA039964. |
| MIM | 609263. gene. |
| neXtProt | NX_Q96EE3. |
| PharmGKB | PA134912135. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG2319. |
| HOGENOM | HOG000216896. |
| InParanoid | Q96EE3. |
| KO | K14299. |
| OMA | YEAPDIM. |
| OrthoDB | EOG4DJJWR. |
| PhylomeDB | Q96EE3. |
Enzyme and pathway databases | |
| Reactome | REACT_111217. Metabolism. REACT_115566. Cell Cycle. REACT_116125. Disease. REACT_15518. Transmembrane transport of small molecules. REACT_21300. Mitotic M-M/G1 phases. REACT_6900. Immune System. |
Gene expression databases | |
| Bgee | Q96EE3. |
| CleanEx | HS_SEH1L. |
| Genevestigator | Q96EE3. |
| GermOnline | ENSG00000085415. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.130.10.10. 2 hits. |
| InterPro | IPR020472. G-protein_beta_WD-40_rep. IPR015943. WD40/YVTN_repeat-like_dom. IPR001680. WD40_repeat. IPR017986. WD40_repeat_dom. [Graphical view] |
| Pfam | PF00400. WD40. 5 hits. [Graphical view] |
| PRINTS | PR00320. GPROTEINBRPT. |
| SMART | SM00320. WD40. 5 hits. [Graphical view] |
| SUPFAM | SSF50978. WD40_like. 1 hit. |
| PROSITE | PS00678. WD_REPEATS_1. False negative. PS50082. WD_REPEATS_2. 2 hits. PS50294. WD_REPEATS_REGION. 2 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SEH1L. human. |
| GenomeRNAi | 81929. |
| NextBio | 72265. |
| SOURCE | Search... |
Entry information
| Entry name | SEH1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96EE3 Secondary accession number(s): A8K5B1 Q9C069 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 18 Human chromosome 18: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
