Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat-containing protein 51

Gene

LRTOMT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

BioCyciZFISH:HS14722-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 51
Alternative name(s):
Protein LRTOMT1
Gene namesi
Name:LRTOMT
Synonyms:LRRC51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:25033. LRTOMT.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi220074.
MalaCardsiLRTOMT.
OpenTargetsiENSG00000184154.
PharmGKBiPA164722133.

Polymorphism and mutation databases

DMDMi74760801.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002255001 – 192Leucine-rich repeat-containing protein 51Add BLAST192

Proteomic databases

EPDiQ96E66.
PeptideAtlasiQ96E66.
PRIDEiQ96E66.

PTM databases

iPTMnetiQ96E66.
PhosphoSitePlusiQ96E66.

Expressioni

Gene expression databases

BgeeiENSG00000184154.
CleanExiHS_LRTOMT.
ExpressionAtlasiQ96E66. baseline and differential.
GenevisibleiQ96E66. HS.

Organism-specific databases

HPAiHPA039949.

Interactioni

Protein-protein interaction databases

BioGridi128624. 2 interactors.

Structurei

3D structure databases

ProteinModelPortaliQ96E66.
SMRiQ96E66.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati49 – 71LRR 1Add BLAST23
Repeati80 – 101LRR 2Add BLAST22
Repeati103 – 124LRR 3Add BLAST22
Domaini137 – 175LRRCTAdd BLAST39

Sequence similaritiesi

Contains 3 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00390000011316.
HOVERGENiHBG055282.
PhylomeDBiQ96E66.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
PROSITEiPS51450. LRR. 4 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96E66-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNKRDYMNTS VQEPPLDYSF RSIHVIQDLV NEEPRTGLRP LKRSKSGKSL
60 70 80 90 100
TQSLWLNNNV LNDLRDFNQV ASQLLEHPEN LAWIDLSFND LTSIDPVLTT
110 120 130 140 150
FFNLSVLYLH GNSIQRLGEV NKLAVLPRLR SLTLHGNPME EEKGYRQYVL
160 170 180 190
CTLSRITTFD FSGVTKADRT TAEVWKRMNI KPKKAWTKQN TL
Length:192
Mass (Da):22,206
Last modified:December 1, 2001 - v1
Checksum:iFABF76A0C1F53A67
GO
Isoform 2 (identifier: Q96E66-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: QYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL → VPGSVEMPHRPP

Show »
Length:158
Mass (Da):18,132
Checksum:i6AC861EC2136838F
GO
Isoform 3 (identifier: Q96E66-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: Missing.

Show »
Length:146
Mass (Da):16,847
Checksum:i8771D5BEABC3F9D4
GO
Isoform 4 (identifier: Q96E66-4) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:227
Mass (Da):24,914
Checksum:i70FB60750230B106
GO
Isoform 5 (identifier: Q96E66-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:187
Mass (Da):21,180
Checksum:i54C4AD20E1AF207C
GO
Isoform 6 (identifier: Q96E66-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MNKRDYMNTSVQEPPLDYSFRSIHVIQ → MVEFQPSVT

Show »
Length:174
Mass (Da):19,974
Checksum:iE54E485D62E670E9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12Q → R in BAG35968 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0418521 – 27MNKRD…IHVIQ → MVEFQPSVT in isoform 6. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_036893146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQGPG RDHVPCHCIGLPATGGNIAG AVPALLPIAGAHGLAAKPPR LPVRAADRGAGLQLRAHPCP AR in isoform 4. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036894146 – 192RQYVL…KQNTL → SRPWTPRPVLCSGPPAQPPR LPVRAADRGAGLQLRAHPCP AR in isoform 5. 1 PublicationAdd BLAST47
Alternative sequenceiVSP_036895147 – 192QYVLC…KQNTL → VPGSVEMPHRPP in isoform 2. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_036896147 – 192Missing in isoform 3. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA. Translation: ACF40876.1.
EU627067 mRNA. Translation: ACF40877.1.
EU627068 mRNA. Translation: ACF40878.1.
EU627069 mRNA. Translation: ACF40879.1.
EU627070 mRNA. Translation: ACF40880.1.
AK298997 mRNA. Translation: BAH12920.1.
AK313150 mRNA. Translation: BAG35968.1.
AP000812 Genomic DNA. No translation available.
AP002490 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74832.1.
BC012855 mRNA. Translation: AAH12855.1.
CCDSiCCDS44667.1. [Q96E66-2]
CCDS55778.1. [Q96E66-6]
CCDS59227.1. [Q96E66-3]
CCDS8208.1. [Q96E66-1]
RefSeqiNP_001138779.1. NM_001145307.4. [Q96E66-2]
NP_001192067.1. NM_001205138.3. [Q96E66-6]
NP_001258400.1. NM_001271471.2. [Q96E66-3]
NP_001305732.1. NM_001318803.1. [Q96E66-1]
NP_660352.1. NM_145309.5. [Q96E66-1]
XP_006718536.1. XM_006718473.3. [Q96E66-1]
XP_006718537.1. XM_006718474.3. [Q96E66-1]
XP_011543149.1. XM_011544847.2. [Q96E66-1]
XP_011543150.1. XM_011544848.2. [Q96E66-1]
XP_016872848.1. XM_017017359.1. [Q96E66-1]
XP_016872849.1. XM_017017360.1. [Q96E66-1]
UniGeneiHs.317243.
Hs.667985.

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154. [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154. [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154. [Q96E66-6]
ENST00000427369; ENSP00000409403; ENSG00000184154. [Q96E66-4]
ENST00000447974; ENSP00000414271; ENSG00000184154. [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154. [Q96E66-3]
ENST00000538478; ENSP00000444583; ENSG00000184154. [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154. [Q96E66-2]
ENST00000544409; ENSP00000440969; ENSG00000184154. [Q96E66-5]
ENST00000615940; ENSP00000482923; ENSG00000184154. [Q96E66-6]
GeneIDi220074.
UCSCiuc001orr.4. human. [Q96E66-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA. Translation: ACF40876.1.
EU627067 mRNA. Translation: ACF40877.1.
EU627068 mRNA. Translation: ACF40878.1.
EU627069 mRNA. Translation: ACF40879.1.
EU627070 mRNA. Translation: ACF40880.1.
AK298997 mRNA. Translation: BAH12920.1.
AK313150 mRNA. Translation: BAG35968.1.
AP000812 Genomic DNA. No translation available.
AP002490 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74832.1.
BC012855 mRNA. Translation: AAH12855.1.
CCDSiCCDS44667.1. [Q96E66-2]
CCDS55778.1. [Q96E66-6]
CCDS59227.1. [Q96E66-3]
CCDS8208.1. [Q96E66-1]
RefSeqiNP_001138779.1. NM_001145307.4. [Q96E66-2]
NP_001192067.1. NM_001205138.3. [Q96E66-6]
NP_001258400.1. NM_001271471.2. [Q96E66-3]
NP_001305732.1. NM_001318803.1. [Q96E66-1]
NP_660352.1. NM_145309.5. [Q96E66-1]
XP_006718536.1. XM_006718473.3. [Q96E66-1]
XP_006718537.1. XM_006718474.3. [Q96E66-1]
XP_011543149.1. XM_011544847.2. [Q96E66-1]
XP_011543150.1. XM_011544848.2. [Q96E66-1]
XP_016872848.1. XM_017017359.1. [Q96E66-1]
XP_016872849.1. XM_017017360.1. [Q96E66-1]
UniGeneiHs.317243.
Hs.667985.

3D structure databases

ProteinModelPortaliQ96E66.
SMRiQ96E66.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128624. 2 interactors.

PTM databases

iPTMnetiQ96E66.
PhosphoSitePlusiQ96E66.

Polymorphism and mutation databases

DMDMi74760801.

Proteomic databases

EPDiQ96E66.
PeptideAtlasiQ96E66.
PRIDEiQ96E66.

Protocols and materials databases

DNASUi220074.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154. [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154. [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154. [Q96E66-6]
ENST00000427369; ENSP00000409403; ENSG00000184154. [Q96E66-4]
ENST00000447974; ENSP00000414271; ENSG00000184154. [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154. [Q96E66-3]
ENST00000538478; ENSP00000444583; ENSG00000184154. [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154. [Q96E66-2]
ENST00000544409; ENSP00000440969; ENSG00000184154. [Q96E66-5]
ENST00000615940; ENSP00000482923; ENSG00000184154. [Q96E66-6]
GeneIDi220074.
UCSCiuc001orr.4. human. [Q96E66-1]

Organism-specific databases

CTDi220074.
DisGeNETi220074.
GeneCardsiLRTOMT.
GeneReviewsiLRTOMT.
HGNCiHGNC:25033. LRTOMT.
HPAiHPA039949.
MalaCardsiLRTOMT.
MIMi612414. gene.
neXtProtiNX_Q96E66.
OpenTargetsiENSG00000184154.
PharmGKBiPA164722133.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011316.
HOVERGENiHBG055282.
PhylomeDBiQ96E66.

Enzyme and pathway databases

BioCyciZFISH:HS14722-MONOMER.

Miscellaneous databases

ChiTaRSiLRTOMT. human.
GenomeRNAii220074.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000184154.
CleanExiHS_LRTOMT.
ExpressionAtlasiQ96E66. baseline and differential.
GenevisibleiQ96E66. HS.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
PROSITEiPS51450. LRR. 4 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiLRC51_HUMAN
AccessioniPrimary (citable) accession number: Q96E66
Secondary accession number(s): B2R7X1
, B6CZ35, B6CZ36, B6CZ37, B6CZ38, B6CZ39, B7Z5I4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: December 1, 2001
Last modified: November 2, 2016
This is version 123 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

In primates, this protein is produced by a bicistronic gene which also produces the TOMT protein from an overlapping reading frame. In rodents, these proteins are produced by 2 separate adjacent genes which together are orthologous to the single primate gene.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.