Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Leucine-rich repeat-containing protein 51

Gene

LRTOMT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Leucine-rich repeat-containing protein 51
Alternative name(s):
Protein LRTOMT1
Gene namesi
Name:LRTOMT
Synonyms:LRRC51
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:25033. LRTOMT.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

MalaCardsiLRTOMT.
PharmGKBiPA164722133.

Polymorphism and mutation databases

DMDMi74760801.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 192192Leucine-rich repeat-containing protein 51PRO_0000225500Add
BLAST

Proteomic databases

EPDiQ96E66.
PeptideAtlasiQ96E66.
PRIDEiQ96E66.

PTM databases

iPTMnetiQ96E66.

Expressioni

Gene expression databases

BgeeiQ96E66.
CleanExiHS_LRTOMT.
ExpressionAtlasiQ96E66. baseline and differential.
GenevisibleiQ96E66. HS.

Organism-specific databases

HPAiHPA039949.

Interactioni

Protein-protein interaction databases

BioGridi128624. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ96E66.
SMRiQ96E66. Positions 44-168.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati49 – 7123LRR 1Add
BLAST
Repeati80 – 10122LRR 2Add
BLAST
Repeati103 – 12422LRR 3Add
BLAST
Domaini137 – 17539LRRCTAdd
BLAST

Sequence similaritiesi

Contains 3 LRR (leucine-rich) repeats.Curated
Contains 1 LRRCT domain.Curated

Keywords - Domaini

Leucine-rich repeat, Repeat

Phylogenomic databases

GeneTreeiENSGT00390000011316.
HOVERGENiHBG055282.
PhylomeDBiQ96E66.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
PROSITEiPS51450. LRR. 4 hits.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96E66-1) [UniParc]FASTAAdd to basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MNKRDYMNTS VQEPPLDYSF RSIHVIQDLV NEEPRTGLRP LKRSKSGKSL
60 70 80 90 100
TQSLWLNNNV LNDLRDFNQV ASQLLEHPEN LAWIDLSFND LTSIDPVLTT
110 120 130 140 150
FFNLSVLYLH GNSIQRLGEV NKLAVLPRLR SLTLHGNPME EEKGYRQYVL
160 170 180 190
CTLSRITTFD FSGVTKADRT TAEVWKRMNI KPKKAWTKQN TL
Length:192
Mass (Da):22,206
Last modified:December 1, 2001 - v1
Checksum:iFABF76A0C1F53A67
GO
Isoform 2 (identifier: Q96E66-2) [UniParc]FASTAAdd to basket

Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: QYVLCTLSRITTFDFSGVTKADRTTAEVWKRMNIKPKKAWTKQNTL → VPGSVEMPHRPP

Show »
Length:158
Mass (Da):18,132
Checksum:i6AC861EC2136838F
GO
Isoform 3 (identifier: Q96E66-3) [UniParc]FASTAAdd to basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     147-192: Missing.

Show »
Length:146
Mass (Da):16,847
Checksum:i8771D5BEABC3F9D4
GO
Isoform 4 (identifier: Q96E66-4) [UniParc]FASTAAdd to basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:227
Mass (Da):24,914
Checksum:i70FB60750230B106
GO
Isoform 5 (identifier: Q96E66-5) [UniParc]FASTAAdd to basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     146-192: RQYVLCTLSR...KKAWTKQNTL → SRPWTPRPVL...QLRAHPCPAR

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:187
Mass (Da):21,180
Checksum:i54C4AD20E1AF207C
GO
Isoform 6 (identifier: Q96E66-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-27: MNKRDYMNTSVQEPPLDYSFRSIHVIQ → MVEFQPSVT

Show »
Length:174
Mass (Da):19,974
Checksum:iE54E485D62E670E9
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti12 – 121Q → R in BAG35968 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 2727MNKRD…IHVIQ → MVEFQPSVT in isoform 6. 1 PublicationVSP_041852Add
BLAST
Alternative sequencei146 – 19247RQYVL…KQNTL → SRPWTPRPVLCSGPPAQGPG RDHVPCHCIGLPATGGNIAG AVPALLPIAGAHGLAAKPPR LPVRAADRGAGLQLRAHPCP AR in isoform 4. 1 PublicationVSP_036893Add
BLAST
Alternative sequencei146 – 19247RQYVL…KQNTL → SRPWTPRPVLCSGPPAQPPR LPVRAADRGAGLQLRAHPCP AR in isoform 5. 1 PublicationVSP_036894Add
BLAST
Alternative sequencei147 – 19246QYVLC…KQNTL → VPGSVEMPHRPP in isoform 2. 1 PublicationVSP_036895Add
BLAST
Alternative sequencei147 – 19246Missing in isoform 3. 1 PublicationVSP_036896Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA. Translation: ACF40876.1.
EU627067 mRNA. Translation: ACF40877.1.
EU627068 mRNA. Translation: ACF40878.1.
EU627069 mRNA. Translation: ACF40879.1.
EU627070 mRNA. Translation: ACF40880.1.
AK298997 mRNA. Translation: BAH12920.1.
AK313150 mRNA. Translation: BAG35968.1.
AP000812 Genomic DNA. No translation available.
AP002490 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74832.1.
BC012855 mRNA. Translation: AAH12855.1.
CCDSiCCDS44667.1. [Q96E66-2]
CCDS55778.1. [Q96E66-6]
CCDS59227.1. [Q96E66-3]
CCDS8208.1. [Q96E66-1]
RefSeqiNP_001138779.1. NM_001145307.4. [Q96E66-2]
NP_001192067.1. NM_001205138.3. [Q96E66-6]
NP_001258400.1. NM_001271471.2. [Q96E66-3]
NP_001305732.1. NM_001318803.1. [Q96E66-1]
NP_660352.1. NM_145309.5. [Q96E66-1]
XP_006718536.1. XM_006718473.2. [Q96E66-1]
XP_006718537.1. XM_006718474.2. [Q96E66-1]
XP_011543149.1. XM_011544847.1. [Q96E66-1]
XP_011543150.1. XM_011544848.1. [Q96E66-1]
UniGeneiHs.317243.
Hs.667985.

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154. [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154. [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154. [Q96E66-6]
ENST00000427369; ENSP00000409403; ENSG00000184154. [Q96E66-4]
ENST00000447974; ENSP00000414271; ENSG00000184154. [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154. [Q96E66-3]
ENST00000538478; ENSP00000444583; ENSG00000184154. [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154. [Q96E66-2]
ENST00000544409; ENSP00000440969; ENSG00000184154. [Q96E66-5]
ENST00000615940; ENSP00000482923; ENSG00000184154. [Q96E66-6]
GeneIDi220074.
KEGGihsa:220074.
UCSCiuc001orr.4. human. [Q96E66-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
EU627066 mRNA. Translation: ACF40876.1.
EU627067 mRNA. Translation: ACF40877.1.
EU627068 mRNA. Translation: ACF40878.1.
EU627069 mRNA. Translation: ACF40879.1.
EU627070 mRNA. Translation: ACF40880.1.
AK298997 mRNA. Translation: BAH12920.1.
AK313150 mRNA. Translation: BAG35968.1.
AP000812 Genomic DNA. No translation available.
AP002490 Genomic DNA. No translation available.
CH471076 Genomic DNA. Translation: EAW74832.1.
BC012855 mRNA. Translation: AAH12855.1.
CCDSiCCDS44667.1. [Q96E66-2]
CCDS55778.1. [Q96E66-6]
CCDS59227.1. [Q96E66-3]
CCDS8208.1. [Q96E66-1]
RefSeqiNP_001138779.1. NM_001145307.4. [Q96E66-2]
NP_001192067.1. NM_001205138.3. [Q96E66-6]
NP_001258400.1. NM_001271471.2. [Q96E66-3]
NP_001305732.1. NM_001318803.1. [Q96E66-1]
NP_660352.1. NM_145309.5. [Q96E66-1]
XP_006718536.1. XM_006718473.2. [Q96E66-1]
XP_006718537.1. XM_006718474.2. [Q96E66-1]
XP_011543149.1. XM_011544847.1. [Q96E66-1]
XP_011543150.1. XM_011544848.1. [Q96E66-1]
UniGeneiHs.317243.
Hs.667985.

3D structure databases

ProteinModelPortaliQ96E66.
SMRiQ96E66. Positions 44-168.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128624. 2 interactions.

PTM databases

iPTMnetiQ96E66.

Polymorphism and mutation databases

DMDMi74760801.

Proteomic databases

EPDiQ96E66.
PeptideAtlasiQ96E66.
PRIDEiQ96E66.

Protocols and materials databases

DNASUi220074.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000289488; ENSP00000289488; ENSG00000184154. [Q96E66-1]
ENST00000324866; ENSP00000440693; ENSG00000184154. [Q96E66-3]
ENST00000423494; ENSP00000441249; ENSG00000184154. [Q96E66-6]
ENST00000427369; ENSP00000409403; ENSG00000184154. [Q96E66-4]
ENST00000447974; ENSP00000414271; ENSG00000184154. [Q96E66-1]
ENST00000536917; ENSP00000443421; ENSG00000184154. [Q96E66-3]
ENST00000538478; ENSP00000444583; ENSG00000184154. [Q96E66-1]
ENST00000541614; ENSP00000438522; ENSG00000184154. [Q96E66-2]
ENST00000544409; ENSP00000440969; ENSG00000184154. [Q96E66-5]
ENST00000615940; ENSP00000482923; ENSG00000184154. [Q96E66-6]
GeneIDi220074.
KEGGihsa:220074.
UCSCiuc001orr.4. human. [Q96E66-1]

Organism-specific databases

CTDi220074.
GeneCardsiLRTOMT.
GeneReviewsiLRTOMT.
HGNCiHGNC:25033. LRTOMT.
HPAiHPA039949.
MalaCardsiLRTOMT.
MIMi612414. gene.
neXtProtiNX_Q96E66.
PharmGKBiPA164722133.
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00390000011316.
HOVERGENiHBG055282.
PhylomeDBiQ96E66.

Miscellaneous databases

ChiTaRSiLRTOMT. human.
GenomeRNAii220074.
SOURCEiSearch...

Gene expression databases

BgeeiQ96E66.
CleanExiHS_LRTOMT.
ExpressionAtlasiQ96E66. baseline and differential.
GenevisibleiQ96E66. HS.

Family and domain databases

Gene3Di3.80.10.10. 1 hit.
InterProiIPR032675. L_dom-like.
IPR001611. Leu-rich_rpt.
[Graphical view]
PROSITEiPS51450. LRR. 4 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4 AND 5).
    Tissue: Brain.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 6).
    Tissue: Brain and Teratocarcinoma.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Ovary.

Entry informationi

Entry nameiLRC51_HUMAN
AccessioniPrimary (citable) accession number: Q96E66
Secondary accession number(s): B2R7X1
, B6CZ35, B6CZ36, B6CZ37, B6CZ38, B6CZ39, B7Z5I4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: December 1, 2001
Last modified: July 6, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

In primates, this protein is produced by a bicistronic gene which also produces the TOMT protein from an overlapping reading frame. In rodents, these proteins are produced by 2 separate adjacent genes which together are orthologous to the single primate gene.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.