Q96E52 (OMA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metalloendopeptidase OMA1, mitochondrial EC=3.4.24.- Alternative name(s): Metalloprotease-related protein 1 Short name=MPRP-1 Overlapping with the m-AAA protease 1 homolog | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Metalloprotease that is part of the quality control system in the inner membrane of mitochondria. Following stress conditions that induce loss of mitochondrial membrane potential, mediates cleavage of OPA1 at S1 position, leading to OPA1 inactivation and negative regulation of mitochondrial fusion. Its role in mitochondrial quality control is essential for regulating lipid metabolism as well as to maintain body temperature and energy expenditure under cold-stress conditions. Ref.6 |
| Cofactor | Binds 1 zinc ion per subunit Potential. |
| Subcellular location | Mitochondrion inner membrane; Multi-pass membrane protein Probable Ref.6. |
| Tissue specificity | Widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver. Ref.1 |
| Post-translational modification | In normal conditions, cleaved into an inactive 40 kDa form. Following CCCP treatment that induces loss of mitochondrial membrane potential, the 40 kDa form is reduced in favor of an active 60 kDa form. Ref.6 |
| Sequence similarities | Belongs to the peptidase M48 family. |
| Caution | Was initially reported to localize in the endoplasmic reticulum (Ref.1). However, it was later shown that it localizes to mitochondrion (Ref.6). |
| Sequence caution | The sequence BAC03583.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. The sequence CAI13522.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13523.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13524.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13525.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13526.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI22238.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96E52-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96E52-2) The sequence of this isoform differs from the canonical sequence as follows: 456-524: ALKIREMCNC...TYIVEKRTGS → LVREEKFIEQPEQIAELTLNSFIQNTEICRS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 13 | 13 | Mitochondrion Potential | ||||||
| Chain | 14 – 524 | 511 | Metalloendopeptidase OMA1, mitochondrial | PRO_0000302809 | |||||
Regions | |||||||||
| Transmembrane | 196 – 216 | 21 | Helical; Potential | ||||||
| Transmembrane | 341 – 361 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 328 | 1 | By similarity | ||||||
| Metal binding | 327 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 331 | 1 | Zinc; catalytic Probable | ||||||
| Metal binding | 392 | 1 | Zinc; catalytic By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 456 – 524 | 69 | ALKIR…KRTGS → LVREEKFIEQPEQIAELTLN SFIQNTEICRS in isoform 2. | VSP_027958 | |||||
| Natural variant | 67 | 1 | N → K. Corresponds to variant rs34466938 [ dbSNP | Ensembl ]. | VAR_034958 | |||||
| Natural variant | 69 | 1 | H → Y in a patient with amyotrophic lateral sclerosis. Ref.8 | VAR_065755 | |||||
| Natural variant | 117 | 1 | P → L. Ref.8 Corresponds to variant rs17117720 [ dbSNP | Ensembl ]. | VAR_034959 | |||||
| Natural variant | 211 | 1 | F → C. Corresponds to variant rs17117699 [ dbSNP | Ensembl ]. | VAR_034960 | |||||
| Natural variant | 226 | 1 | L → V in a colorectal cancer sample; somatic mutation. Ref.7 | VAR_035708 | |||||
| Natural variant | 272 | 1 | E → G in a patient with amyotrophic lateral sclerosis. Ref.8 | VAR_065756 | |||||
| Natural variant | 329 | 1 | I → L. Ref.8 Corresponds to variant rs17117678 [ dbSNP | Ensembl ]. | VAR_034961 | |||||
| Natural variant | 365 | 1 | D → Y. Ref.8 | VAR_065757 | |||||
Experimental info | |||||||||
| Mutagenesis | 331 | 1 | H → A: Abolishes ability to cleave OPA1 at S1 position. Ref.6 | ||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a human cDNA sequence which encodes a novel membrane-associated protein containing a zinc metalloprotease motif." Bao Y.-C., Tsuruga H., Hirai M., Yasuda K., Yokoi N., Kitamura T., Kumagai H. DNA Res. 10:123-128(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. |
| [2] | "The DNA sequence and biological annotation of human chromosome 1." Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K. Bentley D.R.Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Liver. |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 160-524 (ISOFORM 2). Tissue: Substantia nigra. |
| [6] | "Inducible proteolytic inactivation of OPA1 mediated by the OMA1 protease in mammalian cells." Head B., Griparic L., Amiri M., Gandre-Babbe S., van der Bliek A.M. J. Cell Biol. 187:959-966(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, PROTEOLYTIC PROCESSING, MUTAGENESIS OF HIS-331. |
| [7] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] VAL-226. |
| [8] | "Resequencing of 29 candidate genes in patients with familial and sporadic amyotrophic lateral sclerosis." Daoud H., Valdmanis P.N., Gros-Louis F., Belzil V., Spiegelman D., Henrion E., Diallo O., Desjarlais A., Gauthier J., Camu W., Dion P.A., Rouleau G.A. Arch. Neurol. 68:587-593(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANTS TYR-69; LEU-117; GLY-272; LEU-329 AND TYR-365. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB048348 mRNA. Translation: BAC79381.1. AL365187 Genomic DNA. Translation: CAI13522.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13523.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13524.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13525.1. Sequence problems. AL365187, AL109845 Genomic DNA. Translation: CAI13526.1. Sequence problems. AL109845, AL365187 Genomic DNA. Translation: CAI22238.1. Sequence problems. AL365187, AL109845 Genomic DNA. Translation: CAI13527.1. AL109845, AL365187 Genomic DNA. Translation: CAI22239.1. CH471059 Genomic DNA. Translation: EAX06631.1. CH471059 Genomic DNA. Translation: EAX06632.1. CH471059 Genomic DNA. Translation: EAX06633.1. BC012915 mRNA. Translation: AAH12915.1. AK091101 mRNA. Translation: BAC03583.1. Different initiation. |
| IPI | IPI00061229. IPI00168213. |
| RefSeq | NP_660286.1. NM_145243.3. |
| UniGene | Hs.425769. |
3D structure databases | |
| ProteinModelPortal | Q96E52. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000360270. |
Protein family/group databases | |
| MEROPS | M48.017. |
PTM databases | |
| PhosphoSite | Q96E52. |
Polymorphism databases | |
| DMDM | 74751828. |
Proteomic databases | |
| PaxDb | Q96E52. |
| PRIDE | Q96E52. |
Protocols and materials databases | |
| DNASU | 115209. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000358603; ENSP00000351417; ENSG00000162600. ENST00000371226; ENSP00000360270; ENSG00000162600. ENST00000419242; ENSP00000409589; ENSG00000162600. ENST00000426139; ENSP00000416495; ENSG00000162600. ENST00000453710; ENSP00000392978; ENSG00000162600. ENST00000456980; ENSP00000395053; ENSG00000162600. |
| GeneID | 115209. |
| KEGG | hsa:115209. |
| UCSC | uc001cyx.1. human. uc001cyy.3. human. |
Organism-specific databases | |
| CTD | 115209. |
| GeneCards | GC01M058881. |
| H-InvDB | HIX0077405. |
| HGNC | HGNC:29661. OMA1. |
| HPA | HPA055120. |
| neXtProt | NX_Q96E52. |
| PharmGKB | PA134911478. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0501. |
| HOVERGEN | HBG096685. |
| InParanoid | Q96E52. |
| OMA | QKQEQIP. |
| PhylomeDB | Q96E52. |
Gene expression databases | |
| Bgee | Q96E52. |
| CleanEx | HS_OMA1. |
| Genevestigator | Q96E52. |
Family and domain databases | |
| InterPro | IPR001915. Peptidase_M48. [Graphical view] |
| Pfam | PF01435. Peptidase_M48. 1 hit. [Graphical view] |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 115209. |
| NextBio | 79540. |
Entry information
| Entry name | OMA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96E52 Secondary accession number(s): D3DQ54 Q8NBB3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
