Q96E52 (OMA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Metalloendopeptidase OMA1, mitochondrial EC=3.4.24.- Alternative name(s): Metalloprotease-related protein 1 Short name=MPRP-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 524 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Function | Mitochondrial protease By similarity. |
| Cofactor | Binds 1 zinc ion per subunit Potential. |
| Subcellular location | Mitochondrion membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Widely expressed, with strong expression in the heart, skeletal muscle, kidney and liver. Ref.1 |
| Sequence similarities | Belongs to the peptidase M48 family. |
| Caution | According to Ref.1, it localizes in the endoplasmic reticulum. However, the presence of a predicted transit peptide and the mitochondrial localization of orthologous protein in fungi suggests that the endoplasmic reticulum localization is unsure. |
| Sequence caution | The sequence BAC03583.1 differs from that shown. Reason: Erroneous initiation. The sequence CAI13522.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13523.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13524.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13525.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI13526.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence CAI22238.1 differs from that shown. Reason: Erroneous gene model prediction. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane Mitochondrion |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transit peptide Transmembrane Transmembrane helix |
| Ligand | Metal-binding Zinc |
| Molecular function | Hydrolase Metalloprotease Protease |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | proteolysis Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrial membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular function | metal ion binding Inferred from electronic annotation. Source: UniProtKB-KW metalloendopeptidase activityInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96E52-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96E52-2) The sequence of this isoform differs from the canonical sequence as follows: 456-524: ALKIREMCNC...TYIVEKRTGS → LVREEKFIEQPEQIAELTLNSFIQNTEICRS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Transit peptide | 1 – 13 | 13 | Mitochondrion Potential | ||||||
| Chain | 14 – 524 | 511 | Metalloendopeptidase OMA1, mitochondrial | PRO_0000302809 | |||||
Regions | |||||||||
| Transmembrane | 196 – 216 | 21 | Helical; Potential | ||||||
| Transmembrane | 341 – 361 | 21 | Helical; Potential | ||||||
Sites | |||||||||
| Active site | 328 | 1 | By similarity | ||||||
| Metal binding | 327 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 331 | 1 | Zinc; catalytic By similarity | ||||||
| Metal binding | 392 | 1 | Zinc; catalytic By similarity | ||||||
Natural variations | |||||||||
| Alternative sequence | 456 – 524 | 69 | ALKIR…KRTGS → LVREEKFIEQPEQIAELTLN SFIQNTEICRS in isoform 2. | VSP_027958 | |||||
| Natural variant | 67 | 1 | N → K. Corresponds to variant rs34466938 [ dbSNP | Ensembl ]. | VAR_034958 | |||||
| Natural variant | 69 | 1 | H → Y in a patient with amyotrophic lateral sclerosis. Ref.7 | VAR_065755 | |||||
| Natural variant | 117 | 1 | P → L. Ref.7 Corresponds to variant rs17117720 [ dbSNP | Ensembl ]. | VAR_034959 | |||||
| Natural variant | 211 | 1 | F → C. Corresponds to variant rs17117699 [ dbSNP | Ensembl ]. | VAR_034960 | |||||
| Natural variant | 226 | 1 | L → V in a colorectal cancer sample; somatic mutation. Ref.6 | VAR_035708 | |||||
| Natural variant | 272 | 1 | E → G in a patient with amyotrophic lateral sclerosis. Ref.7 | VAR_065756 | |||||
| Natural variant | 329 | 1 | I → L. Ref.7 Corresponds to variant rs17117678 [ dbSNP | Ensembl ]. | VAR_034961 | |||||
| Natural variant | 365 | 1 | D → Y. Ref.7 | VAR_065757 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB048348 mRNA. Translation: BAC79381.1. AL365187 Genomic DNA. Translation: CAI13522.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13523.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13524.1. Sequence problems. AL365187 Genomic DNA. Translation: CAI13525.1. Sequence problems. AL365187, AL109845 Genomic DNA. Translation: CAI13526.1. Sequence problems. AL109845, AL365187 Genomic DNA. Translation: CAI22238.1. Sequence problems. AL365187, AL109845 Genomic DNA. Translation: CAI13527.1. AL109845, AL365187 Genomic DNA. Translation: CAI22239.1. CH471059 Genomic DNA. Translation: EAX06631.1. CH471059 Genomic DNA. Translation: EAX06632.1. CH471059 Genomic DNA. Translation: EAX06633.1. BC012915 mRNA. Translation: AAH12915.1. AK091101 mRNA. Translation: BAC03583.1. Different initiation. |
| IPI | IPI00061229. IPI00168213. |
| RefSeq | NP_660286.1. NM_145243.3. |
| UniGene | Hs.425769. |
3D structure databases | |
| ProteinModelPortal | Q96E52. |
| SMR | Q96E52. Positions 253-338. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q96E52. |
Protein family/group databases | |
| MEROPS | M48.017. |
Polymorphism databases | |
| DMDM | 74751828. |
Proteomic databases | |
| PRIDE | Q96E52. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000371226; ENSP00000360270; ENSG00000162600. |
| GeneID | 115209. |
| KEGG | hsa:115209. |
| UCSC | uc001cyx.1. human. uc001cyy.1. human. |
Organism-specific databases | |
| CTD | 115209. |
| GeneCards | GC01M058881. |
| H-InvDB | HIX0077405. |
| HGNC | HGNC:29661. OMA1. |
| neXtProt | NX_Q96E52. |
| PharmGKB | PA134911478. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04675. |
| GeneTree | ENSGT00390000007027. |
| HOVERGEN | HBG096685. |
| InParanoid | Q96E52. |
| OMA | LEYEAWM. |
| PhylomeDB | Q96E52. |
Gene expression databases | |
| ArrayExpress | Q96E52. |
| Bgee | Q96E52. |
| CleanEx | HS_OMA1. |
| Genevestigator | Q96E52. |
Family and domain databases | |
| InterPro | IPR001915. Peptidase_M48. [Graphical view] |
| Pfam | PF01435. Peptidase_M48. 1 hit. [Graphical view] |
| PROSITE | PS00142. ZINC_PROTEASE. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 79540. |
Entry information
| Entry name | OMA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96E52 Secondary accession number(s): D3DQ54 Q8NBB3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Peptidase families Classification of peptidase families and list of entries |
| Human chromosome 1 Human chromosome 1: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with