Q96E14 (RMI2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 82.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RecQ-mediated genome instability protein 2 Short name=hRMI2 Alternative name(s): BLM-associated protein of 18 kDa Short name=BLAP18 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 147 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential component of the RMI complex, a complex that plays an important role in the processing of homologous recombination intermediates to limit DNA crossover formation in cells. The complex is therefore essential for the stability, localization, and function of complexes containing BLM. In the RMI complex, it is required to target BLM to chromatin and stress-induced nuclear foci and mitotic phosphorylation of BLM. Ref.5 Ref.6 |
| Subunit structure | Component of the RMI complex, containing at least TOP3A, RMI1 and RMI2. The RMI complex interacts with BLM. Ref.5 Ref.6 |
| Subcellular location | Nucleus. Note: Colocalizes with BLM at nuclear DNA repair foci. Ref.5 |
| Post-translational modification | Phosphorylated during mitosis. Ref.6 |
| Sequence similarities | Belongs to the RMI2 family. Contains 1 OB DNA-binding domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | DNA replication |
| Cellular component | Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| PTM | Acetylation Phosphoprotein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | DNA replication Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA nucleusInferred from direct assay. Source: HPA |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96E14-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96E14-2) The sequence of this isoform differs from the canonical sequence as follows: 1-98: MAAAADSFSG...VPRGRPCLVP → MKQTQVGSLFSLGIRNPEPGPVSGTAVPRQLAWKS | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Initiator methionine | 1 | 1 | Removed Ref.7 | |||||||||||||||||||||||||||||||
| Chain | 2 – 147 | 146 | RecQ-mediated genome instability protein 2 | PRO_0000297577 | ||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||
| DNA binding | 44 – 114 | 71 | OB | |||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||
| Modified residue | 2 | 1 | N-acetylalanine Ref.7 | |||||||||||||||||||||||||||||||
| Modified residue | 7 | 1 | Phosphoserine Ref.7 | |||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 98 | 98 | MAAAA…PCLVP → MKQTQVGSLFSLGIRNPEPG PVSGTAVPRQLAWKS in isoform 2. | VSP_027287 | ||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||
| Mutagenesis | 24 | 1 | K → A: Abolishes interaction with RMI1, TOP3A and BLM. Ref.6 | |||||||||||||||||||||||||||||||
| Mutagenesis | 59 | 1 | W → A: According to PubMed:18923083, abolishes interaction with RMI1, TOP3A and BLM. According to PubMed:18923082, does not affects interaction with RMI1 and TOP3A. Ref.6 | |||||||||||||||||||||||||||||||
| Mutagenesis | 100 | 1 | K → A: Does not affect interaction with RMI1, TOP3A and BLM. Ref.6 | |||||||||||||||||||||||||||||||
| Mutagenesis | 121 | 1 | K → A: According to PubMed:18923083, does not affect interaction with RMI1, TOP3A and BLM. According to PubMed:18923082, affects interaction with BLM and the BMI complex. Ref.5 Ref.6 | |||||||||||||||||||||||||||||||
| Mutagenesis | 135 | 1 | W → A: Abolishes interaction with RMI1, TOP3A and BLM. Ref.6 | |||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||
| Helix | 27 – 33 | 7 | ||||||||||||||||||||||||||||||||
| Beta strand | 34 – 36 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 40 – 43 | 4 | ||||||||||||||||||||||||||||||||
| Turn | 46 – 49 | 4 | ||||||||||||||||||||||||||||||||
| Beta strand | 56 – 68 | 13 | ||||||||||||||||||||||||||||||||
| Beta strand | 71 – 76 | 6 | ||||||||||||||||||||||||||||||||
| Beta strand | 79 – 84 | 6 | ||||||||||||||||||||||||||||||||
| Helix | 86 – 88 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 92 – 94 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 101 – 110 | 10 | ||||||||||||||||||||||||||||||||
| Beta strand | 112 – 114 | 3 | ||||||||||||||||||||||||||||||||
| Beta strand | 116 – 124 | 9 | ||||||||||||||||||||||||||||||||
| Helix | 130 – 143 | 14 | ||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [2] | "The sequence and analysis of duplication-rich human chromosome 16." Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. Pennacchio L.A.Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Lung, Lymph, Skin and Testis. |
| [5] | "RMI, a new OB-fold complex essential for Bloom syndrome protein to maintain genome stability." Xu D., Guo R., Sobeck A., Bachrati C.Z., Yang J., Enomoto T., Brown G.W., Hoatlin M.E., Hickson I.D., Wang W. Genes Dev. 22:2843-2855(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE RMI COMPLEX, SUBCELLULAR LOCATION, MUTAGENESIS OF LYS-121. |
| [6] | "BLAP18/RMI2, a novel OB-fold-containing protein, is an essential component of the Bloom helicase-double Holliday junction dissolvasome." Singh T.R., Ali A.M., Busygina V., Raynard S., Fan Q., Du C.-H., Andreassen P.R., Sung P., Meetei A.R. Genes Dev. 22:2856-2868(2008) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, IDENTIFICATION IN THE RMI COMPLEX, IDENTIFICATION BY MASS SPECTROMETRY, PHOSPHORYLATION, MUTAGENESIS OF LYS-24; TRP-59; LYS-100; LYS-121 AND TRP-135. |
| [7] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-7, MASS SPECTROMETRY, CLEAVAGE OF INITIATOR METHIONINE. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK123764 mRNA. Translation: BAG53958.1. AC009121 Genomic DNA. No translation available. CH471112 Genomic DNA. Translation: EAW85155.1. BC013040 mRNA. Translation: AAH13040.2. BC022427 mRNA. Translation: AAH22427.1. BC031016 mRNA. Translation: AAH31016.1. BC039361 mRNA. Translation: AAH39361.1. | ||||||||||||||||||||||||
| IPI | IPI00061111. IPI00647591. | ||||||||||||||||||||||||
| RefSeq | NP_689521.1. NM_152308.1. | ||||||||||||||||||||||||
| UniGene | Hs.347524. | ||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||
| ProteinModelPortal | Q96E14. | ||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||
| DIP | DIP-56480N. | ||||||||||||||||||||||||
| IntAct | Q96E14. 3 interactions. | ||||||||||||||||||||||||
| STRING | 9606.ENSP00000310356. | ||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||
| PhosphoSite | Q96E14. | ||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||
| DMDM | 74731517. | ||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||
| PaxDb | Q96E14. | ||||||||||||||||||||||||
| PRIDE | Q96E14. | ||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||
| Ensembl | ENST00000312499; ENSP00000310356; ENSG00000175643. ENST00000381820; ENSP00000371241; ENSG00000175643. ENST00000572173; ENSP00000461206; ENSG00000175643. | ||||||||||||||||||||||||
| GeneID | 116028. | ||||||||||||||||||||||||
| KEGG | hsa:116028. | ||||||||||||||||||||||||
| UCSC | uc002daw.1. human. | ||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||
| CTD | 116028. | ||||||||||||||||||||||||
| GeneCards | GC16P011343. | ||||||||||||||||||||||||
| H-InvDB | HIX0012817. | ||||||||||||||||||||||||
| HGNC | HGNC:28349. RMI2. | ||||||||||||||||||||||||
| HPA | HPA040995. | ||||||||||||||||||||||||
| MIM | 612426. gene. | ||||||||||||||||||||||||
| neXtProt | NX_Q96E14. | ||||||||||||||||||||||||
| PharmGKB | PA145149635. | ||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||
| eggNOG | NOG27893. | ||||||||||||||||||||||||
| HOGENOM | HOG000154149. | ||||||||||||||||||||||||
| HOVERGEN | HBG108410. | ||||||||||||||||||||||||
| InParanoid | Q96E14. | ||||||||||||||||||||||||
| KO | K15365. | ||||||||||||||||||||||||
| OMA | AAVWMQG. | ||||||||||||||||||||||||
| OrthoDB | EOG44XJJ2. | ||||||||||||||||||||||||
| PhylomeDB | Q96E14. | ||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||
| ArrayExpress | Q96E14. | ||||||||||||||||||||||||
| Bgee | Q96E14. | ||||||||||||||||||||||||
| CleanEx | HS_C16orf75. | ||||||||||||||||||||||||
| Genevestigator | Q96E14. | ||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||
Other | |||||||||||||||||||||||||
| ChiTaRS | RMI2. human. | ||||||||||||||||||||||||
| GenomeRNAi | 116028. | ||||||||||||||||||||||||
| NextBio | 79725. | ||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||
Entry information
| Entry name | RMI2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96E14 Secondary accession number(s): B3KVZ6, Q49AE2, Q8TBL0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 16 Human chromosome 16: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
