SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96DX5

- ASB9_HUMAN

UniProt

Q96DX5 - ASB9_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Ankyrin repeat and SOCS box protein 9
Gene
ASB9
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A.2 Publications

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sitei103 – 1031Essential for binding to CKB
Sitei107 – 1071Essential for binding to CKB

GO - Molecular functioni

  1. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. intracellular signal transduction Source: InterPro
  2. positive regulation of protein catabolic process Source: MGI
  3. protein ubiquitination Source: MGI
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 9
Short name:
ASB-9
Gene namesi
Name:ASB9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:17184. ASB9.

Subcellular locationi

Mitochondrion 1 Publication

GO - Cellular componenti

  1. mitochondrion Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25037.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 294294Ankyrin repeat and SOCS box protein 9
PRO_0000066940Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ96DX5.
PaxDbiQ96DX5.
PRIDEiQ96DX5.

2D gel databases

REPRODUCTION-2DPAGEIPI00179183.

PTM databases

PhosphoSiteiQ96DX5.

Expressioni

Tissue specificityi

Predominantly expressed in testis, kidney, and liver.1 Publication

Gene expression databases

BgeeiQ96DX5.
CleanExiHS_ASB9.
GenevestigatoriQ96DX5.

Organism-specific databases

HPAiCAB004997.
HPA003014.
HPA003060.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CKBP122773EBI-745641,EBI-357706
HIF1ANQ9NWT63EBI-745641,EBI-745632

Protein-protein interaction databases

BioGridi126615. 33 interactions.
IntActiQ96DX5. 5 interactions.
MINTiMINT-5003430.
STRINGi9606.ENSP00000369855.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi21 – 233
Beta strandi31 – 333
Helixi39 – 457
Helixi49 – 579
Helixi72 – 787
Helixi82 – 909
Helixi105 – 1128
Helixi115 – 1239
Helixi137 – 1448
Helixi147 – 1559
Turni165 – 1673
Helixi170 – 1767
Helixi180 – 1889
Helixi202 – 2087
Helixi212 – 2209
Helixi235 – 2384
Helixi244 – 2529
Helixi258 – 26710
Helixi275 – 2806
Beta strandi281 – 2833
Helixi285 – 2917

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
ProteinModelPortaliQ96DX5.
SMRiQ96DX5. Positions 36-294.

Miscellaneous databases

EvolutionaryTraceiQ96DX5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati35 – 6430ANK 1
Add
BLAST
Repeati68 – 9730ANK 2
Add
BLAST
Repeati101 – 13030ANK 3
Add
BLAST
Repeati133 – 16230ANK 4
Add
BLAST
Repeati166 – 19530ANK 5
Add
BLAST
Repeati198 – 22730ANK 6
Add
BLAST
Domaini240 – 29455SOCS box
Add
BLAST

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity.

Sequence similaritiesi

Contains 6 ANK repeats.
Contains 1 SOCS box domain.

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiCOG0666.
HOGENOMiHOG000231513.
HOVERGENiHBG001376.
InParanoidiQ96DX5.
KOiK10331.
OMAiRKCFGIQ.
OrthoDBiEOG7J447G.
PhylomeDBiQ96DX5.
TreeFamiTF331945.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_C.
[Graphical view]
PfamiPF00023. Ank. 1 hit.
PF12796. Ank_2. 1 hit.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS50225. SOCS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96DX5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL    50
SLRNLISQGW AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA 100
DWHTPLFNAC VSGSWDCVNL LLQHGASVQP ESDLASPIHE AARRGHVECV 150
NSLIAYGGNI DHKISHLGTP LYLACENQQR ACVKKLLESG ADVNQGKGQD 200
SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP PESPLAQLFL 250
EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL 294
Length:294
Mass (Da):31,858
Last modified:December 1, 2001 - v1
Checksum:iA1784DCFC294D85A
GO
Isoform 2 (identifier: Q96DX5-2) [UniParc]FASTAAdd to Basket

Also known as: ASB9deltaSOCS

The sequence of this isoform differs from the canonical sequence as follows:
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.

Show »
Length:262
Mass (Da):27,902
Checksum:i9354CAD758EC399F
GO
Isoform 3 (identifier: Q96DX5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-154: Missing.
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: No experimental confirmation available.

Show »
Length:252
Mass (Da):26,849
Checksum:i6FEE897C6B1FF98C
GO

Sequence cautioni

The sequence CAB45706.2 differs from that shown. Reason: Erroneous initiation.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei145 – 15410Missing in isoform 3.
VSP_043158
Alternative sequencei255 – 29440PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3.
VSP_000271Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti192 – 1921D → V in CAB45706. 1 Publication
Sequence conflicti237 – 2371E → G in CAB45706. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000643 mRNA. Translation: BAA91302.1.
AK292270 mRNA. Translation: BAF84959.1.
AL080091 mRNA. Translation: CAB45706.2. Different initiation.
CH471074 Genomic DNA. Translation: EAW98871.1.
CH471074 Genomic DNA. Translation: EAW98874.1.
BC001244 mRNA. Translation: AAH01244.1.
BC013172 mRNA. Translation: AAH13172.1.
CCDSiCCDS14163.1. [Q96DX5-2]
CCDS35208.1. [Q96DX5-1]
CCDS55372.1. [Q96DX5-3]
RefSeqiNP_001026909.1. NM_001031739.2. [Q96DX5-1]
NP_001162002.1. NM_001168530.1. [Q96DX5-3]
NP_001162003.1. NM_001168531.1. [Q96DX5-2]
NP_076992.1. NM_024087.2. [Q96DX5-2]
XP_005274503.1. XM_005274446.1. [Q96DX5-1]
XP_005274505.1. XM_005274448.1. [Q96DX5-2]
UniGeneiHs.19404.

Genome annotation databases

EnsembliENST00000380483; ENSP00000369850; ENSG00000102048. [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048. [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048. [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048. [Q96DX5-2]
GeneIDi140462.
KEGGihsa:140462.
UCSCiuc004cwk.3. human. [Q96DX5-2]
uc004cwl.3. human. [Q96DX5-1]
uc004cwm.3. human. [Q96DX5-3]

Polymorphism databases

DMDMi29839756.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK000643 mRNA. Translation: BAA91302.1 .
AK292270 mRNA. Translation: BAF84959.1 .
AL080091 mRNA. Translation: CAB45706.2 . Different initiation.
CH471074 Genomic DNA. Translation: EAW98871.1 .
CH471074 Genomic DNA. Translation: EAW98874.1 .
BC001244 mRNA. Translation: AAH01244.1 .
BC013172 mRNA. Translation: AAH13172.1 .
CCDSi CCDS14163.1. [Q96DX5-2 ]
CCDS35208.1. [Q96DX5-1 ]
CCDS55372.1. [Q96DX5-3 ]
RefSeqi NP_001026909.1. NM_001031739.2. [Q96DX5-1 ]
NP_001162002.1. NM_001168530.1. [Q96DX5-3 ]
NP_001162003.1. NM_001168531.1. [Q96DX5-2 ]
NP_076992.1. NM_024087.2. [Q96DX5-2 ]
XP_005274503.1. XM_005274446.1. [Q96DX5-1 ]
XP_005274505.1. XM_005274448.1. [Q96DX5-2 ]
UniGenei Hs.19404.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
3D9H X-ray 2.20 A 1-258 [» ]
3ZKJ X-ray 2.58 A/D 35-294 [» ]
3ZNG X-ray 2.85 A/D 35-294 [» ]
ProteinModelPortali Q96DX5.
SMRi Q96DX5. Positions 36-294.
ModBasei Search...

Protein-protein interaction databases

BioGridi 126615. 33 interactions.
IntActi Q96DX5. 5 interactions.
MINTi MINT-5003430.
STRINGi 9606.ENSP00000369855.

PTM databases

PhosphoSitei Q96DX5.

Polymorphism databases

DMDMi 29839756.

2D gel databases

REPRODUCTION-2DPAGE IPI00179183.

Proteomic databases

MaxQBi Q96DX5.
PaxDbi Q96DX5.
PRIDEi Q96DX5.

Protocols and materials databases

DNASUi 140462.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000380483 ; ENSP00000369850 ; ENSG00000102048 . [Q96DX5-3 ]
ENST00000380485 ; ENSP00000369852 ; ENSG00000102048 . [Q96DX5-2 ]
ENST00000380488 ; ENSP00000369855 ; ENSG00000102048 . [Q96DX5-1 ]
ENST00000546332 ; ENSP00000438943 ; ENSG00000102048 . [Q96DX5-2 ]
GeneIDi 140462.
KEGGi hsa:140462.
UCSCi uc004cwk.3. human. [Q96DX5-2 ]
uc004cwl.3. human. [Q96DX5-1 ]
uc004cwm.3. human. [Q96DX5-3 ]

Organism-specific databases

CTDi 140462.
GeneCardsi GC0XM015252.
HGNCi HGNC:17184. ASB9.
HPAi CAB004997.
HPA003014.
HPA003060.
MIMi 300890. gene.
neXtProti NX_Q96DX5.
PharmGKBi PA25037.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG0666.
HOGENOMi HOG000231513.
HOVERGENi HBG001376.
InParanoidi Q96DX5.
KOi K10331.
OMAi RKCFGIQ.
OrthoDBi EOG7J447G.
PhylomeDBi Q96DX5.
TreeFami TF331945.

Enzyme and pathway databases

UniPathwayi UPA00143 .
Reactomei REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

EvolutionaryTracei Q96DX5.
GenomeRNAii 140462.
NextBioi 84125.
PROi Q96DX5.
SOURCEi Search...

Gene expression databases

Bgeei Q96DX5.
CleanExi HS_ASB9.
Genevestigatori Q96DX5.

Family and domain databases

Gene3Di 1.25.40.20. 2 hits.
InterProi IPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_C.
[Graphical view ]
Pfami PF00023. Ank. 1 hit.
PF12796. Ank_2. 1 hit.
PF07525. SOCS_box. 1 hit.
[Graphical view ]
SMARTi SM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view ]
SUPFAMi SSF48403. SSF48403. 1 hit.
PROSITEi PS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS50225. SOCS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Cervix and Skin.
  5. "ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function."
    Kwon S., Kim D., Rhee J.W., Park J.A., Kim D.W., Kim D.S., Lee Y., Kwon H.J.
    BMC Biol. 8:23-23(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  6. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. "Crystal structure of human ASB9-2 and substrate-recognition of CKB."
    Fei X., Gu X., Fan S., Yang Z., Li F., Zhang C., Gong W., Mao Y., Ji C.
    Protein J. 31:275-284(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) (ISOFORM 2), FUNCTION.

Entry informationi

Entry nameiASB9_HUMAN
AccessioniPrimary (citable) accession number: Q96DX5
Secondary accession number(s): A8K8A5
, Q9BVF5, Q9NWS5, Q9Y4T3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi