Reviewed,
UniProtKB/Swiss-Prot Q96DX5 (ASB9_HUMAN)
Last modified
November 24, 2009.
Version 72.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Ankyrin repeat and SOCS box protein 9 Short name=ASB-9 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Complete proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 294 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | May be a substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins By similarity. |
| Pathway | |
| Domain | The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity. |
| Sequence similarities | Contains 6 ANK repeats. Contains 1 SOCS box domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat |
| Technical term | 3D-structure Complete proteome |
| Gene Ontology (GO) | |
| Biological process | intracellular signaling cascade Inferred from electronic annotation. Source: InterPro modification-dependent protein catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96DX5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96DX5-2) The sequence of this isoform differs from the canonical sequence as follows: 255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 294 | 294 | Ankyrin repeat and SOCS box protein 9 | PRO_0000066940 | |||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||
| Repeat | 35 – 64 | 30 | ANK 1 | ||||||||||||||||||||||||||||||||||
| Repeat | 68 – 97 | 30 | ANK 2 | ||||||||||||||||||||||||||||||||||
| Repeat | 101 – 130 | 30 | ANK 3 | ||||||||||||||||||||||||||||||||||
| Repeat | 133 – 162 | 30 | ANK 4 | ||||||||||||||||||||||||||||||||||
| Repeat | 166 – 195 | 30 | ANK 5 | ||||||||||||||||||||||||||||||||||
| Repeat | 198 – 227 | 30 | ANK 6 | ||||||||||||||||||||||||||||||||||
| Domain | 240 – 294 | 55 | SOCS box | ||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||
| Alternative sequence | 255 – 294 | 40 | PPSLM…FLLHL → ASLPKPKP in isoform 2. | VSP_000271 | |||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||
| Sequence conflict | 192 | 1 | D → V in CAB45706. Ref.2 | ||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | E → G in CAB45706. Ref.2 | ||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||
| Helix | 39 – 45 | 7 | |||||||||||||||||||||||||||||||||||
| Helix | 49 – 57 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 72 – 77 | 6 | |||||||||||||||||||||||||||||||||||
| Helix | 82 – 90 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 105 – 111 | 7 | |||||||||||||||||||||||||||||||||||
| Helix | 115 – 123 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 137 – 143 | 7 | |||||||||||||||||||||||||||||||||||
| Helix | 147 – 155 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 170 – 176 | 7 | |||||||||||||||||||||||||||||||||||
| Helix | 180 – 188 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 202 – 208 | 7 | |||||||||||||||||||||||||||||||||||
| Helix | 212 – 220 | 9 | |||||||||||||||||||||||||||||||||||
| Helix | 235 – 238 | 4 | |||||||||||||||||||||||||||||||||||
| Helix | 244 – 253 | 10 | |||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| AK000643 mRNA. Translation: BAA91302.1. AK292270 mRNA. Translation: BAF84959.1. AL080091 mRNA. Translation: CAB45706.2. Different initiation. CH471074 Genomic DNA. Translation: EAW98871.1. BC013172 mRNA. Translation: AAH13172.1. | |||||||||||||
| IPI | IPI00179183. IPI00216580. | ||||||||||||
| RefSeq | NP_001026909.1. NP_076992.1. | ||||||||||||
| UniGene | Hs.19404 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q96DX5. 2 interactions. | ||||||||||||
| STRING | Q96DX5. | ||||||||||||
2-D gel databases | |||||||||||||
| REPRODUCTION-2DPAGE | IPI00179183. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q96DX5. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000380488; ENSP00000369855; ENSG00000102048; Homo sapiens. [Genome view] | ||||||||||||
| GeneID | 140462. | ||||||||||||
| KEGG | hsa:140462. | ||||||||||||
| UCSC | uc004cwk.1. human. uc004cwl.1. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 140462. | ||||||||||||
| GeneCards | GC0XM015172. | ||||||||||||
| HGNC | HGNC:17184. ASB9. | ||||||||||||
| HPA | CAB004997. HPA003014. HPA003060. | ||||||||||||
| PharmGKB | PA25037. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | Q96DX5. | ||||||||||||
| HOVERGEN | Q96DX5. | ||||||||||||
| OMA | SQGWPVN | ||||||||||||
| OrthoDB | EOG9MKR1K | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q96DX5. | ||||||||||||
| Bgee | Q96DX5. | ||||||||||||
| CleanEx | HS_ASB9. | ||||||||||||
| Genevestigator | Q96DX5. | ||||||||||||
| GermOnline | ENSG00000102048. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001496. SOCS_C. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:1.25.40.20. ANK. 1 hit. | ||||||||||||
| Pfam | PF00023. Ank. 6 hits. PF07525. SOCS_box. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00248. ANK. 6 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 5 hits. PS50225. SOCS. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 84125. | ||||||||||||
Entry information
| Entry name | ASB9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96DX5 Secondary accession number(s): A8K8A5, Q9NWS5, Q9Y4T3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


