Q96DX5 (ASB9_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 108.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Ankyrin repeat and SOCS box protein 9 Short name=ASB-9 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 294 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A. Ref.5 Ref.6 |
| Pathway | |
| Subcellular location | |
| Tissue specificity | Predominantly expressed in testis, kidney, and liver. Ref.5 |
| Domain | The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity. |
| Sequence similarities | Contains 6 ANK repeats. Contains 1 SOCS box domain. |
| Sequence caution | The sequence CAB45706.2 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ubl conjugation pathway |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Domain | ANK repeat Repeat |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | intracellular signal transduction Inferred from electronic annotation. Source: InterPro positive regulation of protein catabolic processInferred from direct assay PubMed 17148442. Source: MGI protein ubiquitinationInferred from direct assay PubMed 17148442. Source: MGI |
| Cellular_component | cytoplasm Inferred from direct assay. Source: HPA mitochondrionInferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from direct assay. Source: HPA |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CKB | P12277 | 3 | EBI-745641,EBI-357706 | |
| HIF1AN | Q9NWT6 | 3 | EBI-745641,EBI-745632 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96DX5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96DX5-2) Also known as: ASB9deltaSOCS; The sequence of this isoform differs from the canonical sequence as follows: 255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP | ||||||
| Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1. | ||||||
| Isoform 3 (identifier: Q96DX5-3) The sequence of this isoform differs from the canonical sequence as follows: 145-154: Missing. 255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 294 | 294 | Ankyrin repeat and SOCS box protein 9 | PRO_0000066940 | ||||||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 35 – 64 | 30 | ANK 1 | |||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 68 – 97 | 30 | ANK 2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 101 – 130 | 30 | ANK 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 133 – 162 | 30 | ANK 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 166 – 195 | 30 | ANK 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Repeat | 198 – 227 | 30 | ANK 6 | |||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 240 – 294 | 55 | SOCS box | |||||||||||||||||||||||||||||||||||||||||||||||
Sites | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Site | 103 | 1 | Essential for binding to CKB | |||||||||||||||||||||||||||||||||||||||||||||||
| Site | 107 | 1 | Essential for binding to CKB | |||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 145 – 154 | 10 | Missing in isoform 3. | VSP_043158 | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 255 – 294 | 40 | PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3. | VSP_000271 | ||||||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 192 | 1 | D → V in CAB45706. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 237 | 1 | E → G in CAB45706. Ref.2 | |||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 21 – 23 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 31 – 33 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 39 – 45 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 49 – 57 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 72 – 78 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 82 – 90 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 105 – 112 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 115 – 123 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 137 – 144 | 8 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 147 – 155 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Turn | 165 – 167 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 170 – 176 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 180 – 188 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 202 – 208 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 212 – 220 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 235 – 238 | 4 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 244 – 252 | 9 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 258 – 267 | 10 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 275 – 280 | 6 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 281 – 283 | 3 | ||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 285 – 291 | 7 | ||||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Testis. |
| [2] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Cervix and Skin. |
| [5] | "ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function." Kwon S., Kim D., Rhee J.W., Park J.A., Kim D.W., Kim D.S., Lee Y., Kwon H.J. BMC Biol. 8:23-23(2010) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [6] | "Crystal structure of human ASB9-2 and substrate-recognition of CKB." Fei X., Gu X., Fan S., Yang Z., Li F., Zhang C., Gong W., Mao Y., Ji C. Protein J. 31:275-284(2012) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) (ISOFORM 2), FUNCTION. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK000643 mRNA. Translation: BAA91302.1. AK292270 mRNA. Translation: BAF84959.1. AL080091 mRNA. Translation: CAB45706.2. Different initiation. CH471074 Genomic DNA. Translation: EAW98871.1. CH471074 Genomic DNA. Translation: EAW98874.1. BC001244 mRNA. Translation: AAH01244.1. BC013172 mRNA. Translation: AAH13172.1. | ||||||||||||||||||
| IPI | IPI00179183. IPI00216580. IPI00643086. | ||||||||||||||||||
| RefSeq | NP_001026909.1. NM_001031739.2. NP_001162002.1. NM_001168530.1. NP_001162003.1. NM_001168531.1. NP_076992.1. NM_024087.2. | ||||||||||||||||||
| UniGene | Hs.19404. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q96DX5. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q96DX5. 4 interactions. | ||||||||||||||||||
| MINT | MINT-5003430. | ||||||||||||||||||
| STRING | 9606.ENSP00000369855. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q96DX5. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 29839756. | ||||||||||||||||||
2D gel databases | |||||||||||||||||||
| REPRODUCTION-2DPAGE | IPI00179183. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q96DX5. | ||||||||||||||||||
| PRIDE | Q96DX5. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 140462. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000380483; ENSP00000369850; ENSG00000102048. ENST00000380485; ENSP00000369852; ENSG00000102048. ENST00000380488; ENSP00000369855; ENSG00000102048. ENST00000546332; ENSP00000438943; ENSG00000102048. | ||||||||||||||||||
| GeneID | 140462. | ||||||||||||||||||
| KEGG | hsa:140462. | ||||||||||||||||||
| UCSC | uc004cwk.3. human. uc004cwl.3. human. uc004cwm.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 140462. | ||||||||||||||||||
| GeneCards | GC0XM015252. | ||||||||||||||||||
| HGNC | HGNC:17184. ASB9. | ||||||||||||||||||
| HPA | CAB004997. HPA003014. HPA003060. | ||||||||||||||||||
| MIM | 300890. gene. | ||||||||||||||||||
| neXtProt | NX_Q96DX5. | ||||||||||||||||||
| PharmGKB | PA25037. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | COG0666. | ||||||||||||||||||
| HOGENOM | HOG000231513. | ||||||||||||||||||
| HOVERGEN | HBG001376. | ||||||||||||||||||
| InParanoid | Q96DX5. | ||||||||||||||||||
| KO | K10331. | ||||||||||||||||||
| OMA | SQGWPVN. | ||||||||||||||||||
| OrthoDB | EOG4TB4BS. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||||||||
| UniPathway | UPA00143. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| Bgee | Q96DX5. | ||||||||||||||||||
| CleanEx | HS_ASB9. | ||||||||||||||||||
| Genevestigator | Q96DX5. | ||||||||||||||||||
| GermOnline | ENSG00000102048. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 1.25.40.20. 2 hits. | ||||||||||||||||||
| InterPro | IPR002110. Ankyrin_rpt. IPR020683. Ankyrin_rpt-contain_dom. IPR001496. SOCS_C. [Graphical view] | ||||||||||||||||||
| Pfam | PF12796. Ank_2. 2 hits. PF07525. SOCS_box. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00248. ANK. 6 hits. SM00969. SOCS_box. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF48403. ANK. 1 hit. | ||||||||||||||||||
| PROSITE | PS50297. ANK_REP_REGION. 1 hit. PS50088. ANK_REPEAT. 5 hits. PS50225. SOCS. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q96DX5. | ||||||||||||||||||
| GenomeRNAi | 140462. | ||||||||||||||||||
| NextBio | 84125. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | ASB9_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96DX5 Secondary accession number(s): A8K8A5 Q9Y4T3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PATHWAY comments Index of metabolic and biosynthesis pathways |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
