Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96DX5 (ASB9_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 119. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Ankyrin repeat and SOCS box protein 9

Short name=ASB-9
Gene names
Name:ASB9
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length294 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A. Ref.5 Ref.7

Pathway

Protein modification; protein ubiquitination.

Subcellular location

Mitochondrion Ref.5.

Tissue specificity

Predominantly expressed in testis, kidney, and liver. Ref.5

Domain

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes By similarity.

Sequence similarities

Contains 6 ANK repeats.

Contains 1 SOCS box domain.

Sequence caution

The sequence CAB45706.2 differs from that shown. Reason: Erroneous initiation.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

CKBP122773EBI-745641,EBI-357706
HIF1ANQ9NWT63EBI-745641,EBI-745632

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q96DX5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96DX5-2)

Also known as: ASB9deltaSOCS;

The sequence of this isoform differs from the canonical sequence as follows:
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP
Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.
Isoform 3 (identifier: Q96DX5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     145-154: Missing.
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 294294Ankyrin repeat and SOCS box protein 9
PRO_0000066940

Regions

Repeat35 – 6430ANK 1
Repeat68 – 9730ANK 2
Repeat101 – 13030ANK 3
Repeat133 – 16230ANK 4
Repeat166 – 19530ANK 5
Repeat198 – 22730ANK 6
Domain240 – 29455SOCS box

Sites

Site1031Essential for binding to CKB
Site1071Essential for binding to CKB

Amino acid modifications

Modified residue11N-acetylmethionine Ref.6

Natural variations

Alternative sequence145 – 15410Missing in isoform 3.
VSP_043158
Alternative sequence255 – 29440PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3.
VSP_000271

Experimental info

Sequence conflict1921D → V in CAB45706. Ref.2
Sequence conflict2371E → G in CAB45706. Ref.2

Secondary structure

.......................................... 294
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified December 1, 2001. Version 1.
Checksum: A1784DCFC294D85A

FASTA29431,858
        10         20         30         40         50         60 
MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL SLRNLISQGW 

        70         80         90        100        110        120 
AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA DWHTPLFNAC VSGSWDCVNL 

       130        140        150        160        170        180 
LLQHGASVQP ESDLASPIHE AARRGHVECV NSLIAYGGNI DHKISHLGTP LYLACENQQR 

       190        200        210        220        230        240 
ACVKKLLESG ADVNQGKGQD SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP 

       250        260        270        280        290 
PESPLAQLFL EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL 

« Hide

Isoform 2 (ASB9deltaSOCS) [UniParc].

Checksum: 9354CAD758EC399F
Show »

FASTA26227,902
Isoform 3 [UniParc].

Checksum: 6FEE897C6B1FF98C
Show »

FASTA25226,849

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[2]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain.
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
Tissue: Cervix and Skin.
[5]"ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function."
Kwon S., Kim D., Rhee J.W., Park J.A., Kim D.W., Kim D.S., Lee Y., Kwon H.J.
BMC Biol. 8:23-23(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[6]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"Crystal structure of human ASB9-2 and substrate-recognition of CKB."
Fei X., Gu X., Fan S., Yang Z., Li F., Zhang C., Gong W., Mao Y., Ji C.
Protein J. 31:275-284(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) (ISOFORM 2), FUNCTION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK000643 mRNA. Translation: BAA91302.1.
AK292270 mRNA. Translation: BAF84959.1.
AL080091 mRNA. Translation: CAB45706.2. Different initiation.
CH471074 Genomic DNA. Translation: EAW98871.1.
CH471074 Genomic DNA. Translation: EAW98874.1.
BC001244 mRNA. Translation: AAH01244.1.
BC013172 mRNA. Translation: AAH13172.1.
CCDSCCDS14163.1. [Q96DX5-2]
CCDS35208.1. [Q96DX5-1]
CCDS55372.1. [Q96DX5-3]
RefSeqNP_001026909.1. NM_001031739.2. [Q96DX5-1]
NP_001162002.1. NM_001168530.1. [Q96DX5-3]
NP_001162003.1. NM_001168531.1. [Q96DX5-2]
NP_076992.1. NM_024087.2. [Q96DX5-2]
XP_005274503.1. XM_005274446.1. [Q96DX5-1]
XP_005274505.1. XM_005274448.1. [Q96DX5-2]
UniGeneHs.19404.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
ProteinModelPortalQ96DX5.
SMRQ96DX5. Positions 36-294.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid126615. 31 interactions.
IntActQ96DX5. 5 interactions.
MINTMINT-5003430.
STRING9606.ENSP00000369855.

PTM databases

PhosphoSiteQ96DX5.

Polymorphism databases

DMDM29839756.

2D gel databases

REPRODUCTION-2DPAGEIPI00179183.

Proteomic databases

MaxQBQ96DX5.
PaxDbQ96DX5.
PRIDEQ96DX5.

Protocols and materials databases

DNASU140462.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000380483; ENSP00000369850; ENSG00000102048. [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048. [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048. [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048. [Q96DX5-2]
GeneID140462.
KEGGhsa:140462.
UCSCuc004cwk.3. human. [Q96DX5-2]
uc004cwl.3. human. [Q96DX5-1]
uc004cwm.3. human. [Q96DX5-3]

Organism-specific databases

CTD140462.
GeneCardsGC0XM015252.
HGNCHGNC:17184. ASB9.
HPACAB004997.
HPA003014.
HPA003060.
MIM300890. gene.
neXtProtNX_Q96DX5.
PharmGKBPA25037.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0666.
HOGENOMHOG000231513.
HOVERGENHBG001376.
InParanoidQ96DX5.
KOK10331.
OMARKCFGIQ.
OrthoDBEOG7J447G.
PhylomeDBQ96DX5.
TreeFamTF331945.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.
UniPathwayUPA00143.

Gene expression databases

BgeeQ96DX5.
CleanExHS_ASB9.
GenevestigatorQ96DX5.

Family and domain databases

Gene3D1.25.40.20. 2 hits.
InterProIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_C.
[Graphical view]
PfamPF00023. Ank. 1 hit.
PF12796. Ank_2. 1 hit.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMSSF48403. SSF48403. 1 hit.
PROSITEPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS50225. SOCS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ96DX5.
GenomeRNAi140462.
NextBio84125.
PROQ96DX5.
SOURCESearch...

Entry information

Entry nameASB9_HUMAN
AccessionPrimary (citable) accession number: Q96DX5
Secondary accession number(s): A8K8A5 expand/collapse secondary AC list , Q9BVF5, Q9NWS5, Q9Y4T3
Entry history
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: December 1, 2001
Last modified: July 9, 2014
This is version 119 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM