Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Ankyrin repeat and SOCS box protein 9

Gene

ASB9

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A.1 Publication

Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei103Essential for binding to CKB1
Sitei107Essential for binding to CKB1

GO - Biological processi

  • intracellular signal transduction Source: InterPro
  • positive regulation of protein catabolic process Source: MGI
  • protein ubiquitination Source: MGI
Complete GO annotation...

Keywords - Biological processi

Ubl conjugation pathway

Enzyme and pathway databases

ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.
UniPathwayiUPA00143.

Names & Taxonomyi

Protein namesi
Recommended name:
Ankyrin repeat and SOCS box protein 9
Short name:
ASB-9
Gene namesi
Name:ASB9
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:17184. ASB9.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Mitochondrion

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000102048.
PharmGKBiPA25037.

Polymorphism and mutation databases

BioMutaiASB9.
DMDMi29839756.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000669401 – 294Ankyrin repeat and SOCS box protein 9Add BLAST294

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1
Modified residuei51PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ96DX5.
MaxQBiQ96DX5.
PaxDbiQ96DX5.
PeptideAtlasiQ96DX5.
PRIDEiQ96DX5.

2D gel databases

REPRODUCTION-2DPAGEIPI00179183.

PTM databases

iPTMnetiQ96DX5.
PhosphoSitePlusiQ96DX5.

Expressioni

Tissue specificityi

Predominantly expressed in testis, kidney, and liver.1 Publication

Gene expression databases

BgeeiENSG00000102048.
CleanExiHS_ASB9.
ExpressionAtlasiQ96DX5. baseline and differential.
GenevisibleiQ96DX5. HS.

Organism-specific databases

HPAiCAB004997.
HPA003014.
HPA003060.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
CKBP122778EBI-745641,EBI-357706
CKMP067326EBI-745641,EBI-4287089
CRKP461082EBI-745641,EBI-886
HEL-S-29V9HWH23EBI-745641,EBI-10284791
HIF1ANQ9NWT63EBI-745641,EBI-745632

Protein-protein interaction databases

BioGridi126615. 35 interactors.
IntActiQ96DX5. 8 interactors.
MINTiMINT-5003430.
STRINGi9606.ENSP00000369855.

Structurei

Secondary structure

1294
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi21 – 23Combined sources3
Beta strandi31 – 33Combined sources3
Helixi39 – 45Combined sources7
Helixi49 – 57Combined sources9
Helixi72 – 78Combined sources7
Helixi82 – 90Combined sources9
Helixi105 – 112Combined sources8
Helixi115 – 123Combined sources9
Helixi137 – 144Combined sources8
Helixi147 – 155Combined sources9
Turni165 – 167Combined sources3
Helixi170 – 176Combined sources7
Helixi180 – 188Combined sources9
Helixi202 – 208Combined sources7
Helixi212 – 220Combined sources9
Helixi235 – 238Combined sources4
Helixi244 – 252Combined sources9
Helixi258 – 267Combined sources10
Helixi275 – 280Combined sources6
Beta strandi281 – 283Combined sources3
Helixi285 – 291Combined sources7

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
ProteinModelPortaliQ96DX5.
SMRiQ96DX5.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ96DX5.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati35 – 64ANK 1Add BLAST30
Repeati68 – 97ANK 2Add BLAST30
Repeati101 – 130ANK 3Add BLAST30
Repeati133 – 162ANK 4Add BLAST30
Repeati166 – 195ANK 5Add BLAST30
Repeati198 – 227ANK 6Add BLAST30
Domaini240 – 294SOCS boxPROSITE-ProRule annotationAdd BLAST55

Domaini

The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

Sequence similaritiesi

Belongs to the ankyrin SOCS box (ASB) family.Curated
Contains 6 ANK repeats.PROSITE-ProRule annotation
Contains 1 SOCS box domain.PROSITE-ProRule annotation

Keywords - Domaini

ANK repeat, Repeat

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00730000110500.
HOGENOMiHOG000231513.
HOVERGENiHBG001376.
InParanoidiQ96DX5.
KOiK10331.
OMAiRKCFGIQ.
OrthoDBiEOG091G0DYR.
PhylomeDBiQ96DX5.
TreeFamiTF331945.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS50225. SOCS. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96DX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL
60 70 80 90 100
SLRNLISQGW AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA
110 120 130 140 150
DWHTPLFNAC VSGSWDCVNL LLQHGASVQP ESDLASPIHE AARRGHVECV
160 170 180 190 200
NSLIAYGGNI DHKISHLGTP LYLACENQQR ACVKKLLESG ADVNQGKGQD
210 220 230 240 250
SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP PESPLAQLFL
260 270 280 290
EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL
Length:294
Mass (Da):31,858
Last modified:December 1, 2001 - v1
Checksum:iA1784DCFC294D85A
GO
Isoform 2 (identifier: Q96DX5-2) [UniParc]FASTAAdd to basket
Also known as: ASB9deltaSOCS

The sequence of this isoform differs from the canonical sequence as follows:
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.
Show »
Length:262
Mass (Da):27,902
Checksum:i9354CAD758EC399F
GO
Isoform 3 (identifier: Q96DX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-154: Missing.
     255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

Note: No experimental confirmation available.
Show »
Length:252
Mass (Da):26,849
Checksum:i6FEE897C6B1FF98C
GO

Sequence cautioni

The sequence CAB45706 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti192D → V in CAB45706 (PubMed:17974005).Curated1
Sequence conflicti237E → G in CAB45706 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_043158145 – 154Missing in isoform 3. 1 Publication10
Alternative sequenceiVSP_000271255 – 294PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3. 3 PublicationsAdd BLAST40

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000643 mRNA. Translation: BAA91302.1.
AK292270 mRNA. Translation: BAF84959.1.
AL080091 mRNA. Translation: CAB45706.2. Different initiation.
CH471074 Genomic DNA. Translation: EAW98871.1.
CH471074 Genomic DNA. Translation: EAW98874.1.
BC001244 mRNA. Translation: AAH01244.1.
BC013172 mRNA. Translation: AAH13172.1.
CCDSiCCDS14163.1. [Q96DX5-2]
CCDS35208.1. [Q96DX5-1]
CCDS55372.1. [Q96DX5-3]
RefSeqiNP_001026909.1. NM_001031739.2. [Q96DX5-1]
NP_001162002.1. NM_001168530.1. [Q96DX5-3]
NP_001162003.1. NM_001168531.1. [Q96DX5-2]
NP_076992.1. NM_024087.2. [Q96DX5-2]
XP_005274503.1. XM_005274446.1. [Q96DX5-1]
UniGeneiHs.19404.

Genome annotation databases

EnsembliENST00000380483; ENSP00000369850; ENSG00000102048. [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048. [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048. [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048. [Q96DX5-2]
GeneIDi140462.
KEGGihsa:140462.
UCSCiuc004cwk.4. human. [Q96DX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000643 mRNA. Translation: BAA91302.1.
AK292270 mRNA. Translation: BAF84959.1.
AL080091 mRNA. Translation: CAB45706.2. Different initiation.
CH471074 Genomic DNA. Translation: EAW98871.1.
CH471074 Genomic DNA. Translation: EAW98874.1.
BC001244 mRNA. Translation: AAH01244.1.
BC013172 mRNA. Translation: AAH13172.1.
CCDSiCCDS14163.1. [Q96DX5-2]
CCDS35208.1. [Q96DX5-1]
CCDS55372.1. [Q96DX5-3]
RefSeqiNP_001026909.1. NM_001031739.2. [Q96DX5-1]
NP_001162002.1. NM_001168530.1. [Q96DX5-3]
NP_001162003.1. NM_001168531.1. [Q96DX5-2]
NP_076992.1. NM_024087.2. [Q96DX5-2]
XP_005274503.1. XM_005274446.1. [Q96DX5-1]
UniGeneiHs.19404.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3D9HX-ray2.20A1-258[»]
3ZKJX-ray2.58A/D35-294[»]
3ZNGX-ray2.85A/D35-294[»]
ProteinModelPortaliQ96DX5.
SMRiQ96DX5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126615. 35 interactors.
IntActiQ96DX5. 8 interactors.
MINTiMINT-5003430.
STRINGi9606.ENSP00000369855.

PTM databases

iPTMnetiQ96DX5.
PhosphoSitePlusiQ96DX5.

Polymorphism and mutation databases

BioMutaiASB9.
DMDMi29839756.

2D gel databases

REPRODUCTION-2DPAGEIPI00179183.

Proteomic databases

EPDiQ96DX5.
MaxQBiQ96DX5.
PaxDbiQ96DX5.
PeptideAtlasiQ96DX5.
PRIDEiQ96DX5.

Protocols and materials databases

DNASUi140462.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000380483; ENSP00000369850; ENSG00000102048. [Q96DX5-3]
ENST00000380485; ENSP00000369852; ENSG00000102048. [Q96DX5-2]
ENST00000380488; ENSP00000369855; ENSG00000102048. [Q96DX5-1]
ENST00000546332; ENSP00000438943; ENSG00000102048. [Q96DX5-2]
GeneIDi140462.
KEGGihsa:140462.
UCSCiuc004cwk.4. human. [Q96DX5-1]

Organism-specific databases

CTDi140462.
GeneCardsiASB9.
HGNCiHGNC:17184. ASB9.
HPAiCAB004997.
HPA003014.
HPA003060.
MIMi300890. gene.
neXtProtiNX_Q96DX5.
OpenTargetsiENSG00000102048.
PharmGKBiPA25037.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0504. Eukaryota.
COG0666. LUCA.
GeneTreeiENSGT00730000110500.
HOGENOMiHOG000231513.
HOVERGENiHBG001376.
InParanoidiQ96DX5.
KOiK10331.
OMAiRKCFGIQ.
OrthoDBiEOG091G0DYR.
PhylomeDBiQ96DX5.
TreeFamiTF331945.

Enzyme and pathway databases

UniPathwayiUPA00143.
ReactomeiR-HSA-983168. Antigen processing: Ubiquitination & Proteasome degradation.

Miscellaneous databases

EvolutionaryTraceiQ96DX5.
GenomeRNAii140462.
PROiQ96DX5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000102048.
CleanExiHS_ASB9.
ExpressionAtlasiQ96DX5. baseline and differential.
GenevisibleiQ96DX5. HS.

Family and domain databases

Gene3Di1.25.40.20. 2 hits.
InterProiIPR002110. Ankyrin_rpt.
IPR020683. Ankyrin_rpt-contain_dom.
IPR001496. SOCS_box.
[Graphical view]
PfamiPF12796. Ank_2. 2 hits.
PF07525. SOCS_box. 1 hit.
[Graphical view]
SMARTiSM00248. ANK. 6 hits.
SM00969. SOCS_box. 1 hit.
[Graphical view]
SUPFAMiSSF158235. SSF158235. 1 hit.
SSF48403. SSF48403. 1 hit.
PROSITEiPS50297. ANK_REP_REGION. 1 hit.
PS50088. ANK_REPEAT. 5 hits.
PS50225. SOCS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiASB9_HUMAN
AccessioniPrimary (citable) accession number: Q96DX5
Secondary accession number(s): A8K8A5
, Q9BVF5, Q9NWS5, Q9Y4T3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 28, 2003
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.