Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96DX5

- ASB9_HUMAN

UniProt

Q96DX5 - ASB9_HUMAN

Protein

Ankyrin repeat and SOCS box protein 9

Gene

ASB9

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 121 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Substrate-recognition component of a SCF-like ECS (Elongin-Cullin-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Recognizes at least two forms of creatine kinase, CKB and CKMT1A.1 Publication

    Pathwayi

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sitei103 – 1031Essential for binding to CKB
    Sitei107 – 1071Essential for binding to CKB

    GO - Molecular functioni

    1. protein binding Source: IntAct

    GO - Biological processi

    1. intracellular signal transduction Source: InterPro
    2. positive regulation of protein catabolic process Source: MGI
    3. protein ubiquitination Source: MGI

    Keywords - Biological processi

    Ubl conjugation pathway

    Enzyme and pathway databases

    ReactomeiREACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.
    UniPathwayiUPA00143.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Ankyrin repeat and SOCS box protein 9
    Short name:
    ASB-9
    Gene namesi
    Name:ASB9
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:17184. ASB9.

    Subcellular locationi

    Mitochondrion 1 Publication

    GO - Cellular componenti

    1. mitochondrion Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Mitochondrion

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA25037.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 294294Ankyrin repeat and SOCS box protein 9PRO_0000066940Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ96DX5.
    PaxDbiQ96DX5.
    PRIDEiQ96DX5.

    2D gel databases

    REPRODUCTION-2DPAGEIPI00179183.

    PTM databases

    PhosphoSiteiQ96DX5.

    Expressioni

    Tissue specificityi

    Predominantly expressed in testis, kidney, and liver.1 Publication

    Gene expression databases

    BgeeiQ96DX5.
    CleanExiHS_ASB9.
    GenevestigatoriQ96DX5.

    Organism-specific databases

    HPAiCAB004997.
    HPA003014.
    HPA003060.

    Interactioni

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    CKBP122773EBI-745641,EBI-357706
    HIF1ANQ9NWT63EBI-745641,EBI-745632

    Protein-protein interaction databases

    BioGridi126615. 33 interactions.
    IntActiQ96DX5. 5 interactions.
    MINTiMINT-5003430.
    STRINGi9606.ENSP00000369855.

    Structurei

    Secondary structure

    1
    294
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi21 – 233
    Beta strandi31 – 333
    Helixi39 – 457
    Helixi49 – 579
    Helixi72 – 787
    Helixi82 – 909
    Helixi105 – 1128
    Helixi115 – 1239
    Helixi137 – 1448
    Helixi147 – 1559
    Turni165 – 1673
    Helixi170 – 1767
    Helixi180 – 1889
    Helixi202 – 2087
    Helixi212 – 2209
    Helixi235 – 2384
    Helixi244 – 2529
    Helixi258 – 26710
    Helixi275 – 2806
    Beta strandi281 – 2833
    Helixi285 – 2917

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    3D9HX-ray2.20A1-258[»]
    3ZKJX-ray2.58A/D35-294[»]
    3ZNGX-ray2.85A/D35-294[»]
    ProteinModelPortaliQ96DX5.
    SMRiQ96DX5. Positions 36-294.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96DX5.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Repeati35 – 6430ANK 1Add
    BLAST
    Repeati68 – 9730ANK 2Add
    BLAST
    Repeati101 – 13030ANK 3Add
    BLAST
    Repeati133 – 16230ANK 4Add
    BLAST
    Repeati166 – 19530ANK 5Add
    BLAST
    Repeati198 – 22730ANK 6Add
    BLAST
    Domaini240 – 29455SOCS boxPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The SOCS box domain mediates the interaction with the Elongin BC complex, an adapter module in different E3 ubiquitin-protein ligase complexes.By similarity

    Sequence similaritiesi

    Contains 6 ANK repeats.PROSITE-ProRule annotation
    Contains 1 SOCS box domain.PROSITE-ProRule annotation

    Keywords - Domaini

    ANK repeat, Repeat

    Phylogenomic databases

    eggNOGiCOG0666.
    HOGENOMiHOG000231513.
    HOVERGENiHBG001376.
    InParanoidiQ96DX5.
    KOiK10331.
    OMAiRKCFGIQ.
    OrthoDBiEOG7J447G.
    PhylomeDBiQ96DX5.
    TreeFamiTF331945.

    Family and domain databases

    Gene3Di1.25.40.20. 2 hits.
    InterProiIPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR001496. SOCS_C.
    [Graphical view]
    PfamiPF00023. Ank. 1 hit.
    PF12796. Ank_2. 1 hit.
    PF07525. SOCS_box. 1 hit.
    [Graphical view]
    SMARTiSM00248. ANK. 6 hits.
    SM00969. SOCS_box. 1 hit.
    [Graphical view]
    SUPFAMiSSF48403. SSF48403. 1 hit.
    PROSITEiPS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 5 hits.
    PS50225. SOCS. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96DX5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MDGKQGGMDG SKPAGPRDFP GIRLLSNPLM GDAVSDWSPM HEAAIHGHQL    50
    SLRNLISQGW AVNIITADHV SPLHEACLGG HLSCVKILLK HGAQVNGVTA 100
    DWHTPLFNAC VSGSWDCVNL LLQHGASVQP ESDLASPIHE AARRGHVECV 150
    NSLIAYGGNI DHKISHLGTP LYLACENQQR ACVKKLLESG ADVNQGKGQD 200
    SPLHAVARTA SEELACLLMD FGADTQAKNA EGKRPVELVP PESPLAQLFL 250
    EREGPPSLMQ LCRLRIRKCF GIQQHHKITK LVLPEDLKQF LLHL 294
    Length:294
    Mass (Da):31,858
    Last modified:December 1, 2001 - v1
    Checksum:iA1784DCFC294D85A
    GO
    Isoform 2 (identifier: Q96DX5-2) [UniParc]FASTAAdd to Basket

    Also known as: ASB9deltaSOCS

    The sequence of this isoform differs from the canonical sequence as follows:
         255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

    Note: Does not interact with the Elongin BC complex, likely to be a negative regulator of isoform 1.

    Show »
    Length:262
    Mass (Da):27,902
    Checksum:i9354CAD758EC399F
    GO
    Isoform 3 (identifier: Q96DX5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         145-154: Missing.
         255-294: PPSLMQLCRLRIRKCFGIQQHHKITKLVLPEDLKQFLLHL → ASLPKPKP

    Note: No experimental confirmation available.

    Show »
    Length:252
    Mass (Da):26,849
    Checksum:i6FEE897C6B1FF98C
    GO

    Sequence cautioni

    The sequence CAB45706.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti192 – 1921D → V in CAB45706. (PubMed:17974005)Curated
    Sequence conflicti237 – 2371E → G in CAB45706. (PubMed:17974005)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei145 – 15410Missing in isoform 3. 1 PublicationVSP_043158
    Alternative sequencei255 – 29440PPSLM…FLLHL → ASLPKPKP in isoform 2 and isoform 3. 3 PublicationsVSP_000271Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000643 mRNA. Translation: BAA91302.1.
    AK292270 mRNA. Translation: BAF84959.1.
    AL080091 mRNA. Translation: CAB45706.2. Different initiation.
    CH471074 Genomic DNA. Translation: EAW98871.1.
    CH471074 Genomic DNA. Translation: EAW98874.1.
    BC001244 mRNA. Translation: AAH01244.1.
    BC013172 mRNA. Translation: AAH13172.1.
    CCDSiCCDS14163.1. [Q96DX5-2]
    CCDS35208.1. [Q96DX5-1]
    CCDS55372.1. [Q96DX5-3]
    RefSeqiNP_001026909.1. NM_001031739.2. [Q96DX5-1]
    NP_001162002.1. NM_001168530.1. [Q96DX5-3]
    NP_001162003.1. NM_001168531.1. [Q96DX5-2]
    NP_076992.1. NM_024087.2. [Q96DX5-2]
    XP_005274503.1. XM_005274446.1. [Q96DX5-1]
    XP_005274505.1. XM_005274448.1. [Q96DX5-2]
    UniGeneiHs.19404.

    Genome annotation databases

    EnsembliENST00000380483; ENSP00000369850; ENSG00000102048. [Q96DX5-3]
    ENST00000380485; ENSP00000369852; ENSG00000102048. [Q96DX5-2]
    ENST00000380488; ENSP00000369855; ENSG00000102048. [Q96DX5-1]
    ENST00000546332; ENSP00000438943; ENSG00000102048. [Q96DX5-2]
    GeneIDi140462.
    KEGGihsa:140462.
    UCSCiuc004cwk.3. human. [Q96DX5-2]
    uc004cwl.3. human. [Q96DX5-1]
    uc004cwm.3. human. [Q96DX5-3]

    Polymorphism databases

    DMDMi29839756.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK000643 mRNA. Translation: BAA91302.1 .
    AK292270 mRNA. Translation: BAF84959.1 .
    AL080091 mRNA. Translation: CAB45706.2 . Different initiation.
    CH471074 Genomic DNA. Translation: EAW98871.1 .
    CH471074 Genomic DNA. Translation: EAW98874.1 .
    BC001244 mRNA. Translation: AAH01244.1 .
    BC013172 mRNA. Translation: AAH13172.1 .
    CCDSi CCDS14163.1. [Q96DX5-2 ]
    CCDS35208.1. [Q96DX5-1 ]
    CCDS55372.1. [Q96DX5-3 ]
    RefSeqi NP_001026909.1. NM_001031739.2. [Q96DX5-1 ]
    NP_001162002.1. NM_001168530.1. [Q96DX5-3 ]
    NP_001162003.1. NM_001168531.1. [Q96DX5-2 ]
    NP_076992.1. NM_024087.2. [Q96DX5-2 ]
    XP_005274503.1. XM_005274446.1. [Q96DX5-1 ]
    XP_005274505.1. XM_005274448.1. [Q96DX5-2 ]
    UniGenei Hs.19404.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    3D9H X-ray 2.20 A 1-258 [» ]
    3ZKJ X-ray 2.58 A/D 35-294 [» ]
    3ZNG X-ray 2.85 A/D 35-294 [» ]
    ProteinModelPortali Q96DX5.
    SMRi Q96DX5. Positions 36-294.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 126615. 33 interactions.
    IntActi Q96DX5. 5 interactions.
    MINTi MINT-5003430.
    STRINGi 9606.ENSP00000369855.

    PTM databases

    PhosphoSitei Q96DX5.

    Polymorphism databases

    DMDMi 29839756.

    2D gel databases

    REPRODUCTION-2DPAGE IPI00179183.

    Proteomic databases

    MaxQBi Q96DX5.
    PaxDbi Q96DX5.
    PRIDEi Q96DX5.

    Protocols and materials databases

    DNASUi 140462.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000380483 ; ENSP00000369850 ; ENSG00000102048 . [Q96DX5-3 ]
    ENST00000380485 ; ENSP00000369852 ; ENSG00000102048 . [Q96DX5-2 ]
    ENST00000380488 ; ENSP00000369855 ; ENSG00000102048 . [Q96DX5-1 ]
    ENST00000546332 ; ENSP00000438943 ; ENSG00000102048 . [Q96DX5-2 ]
    GeneIDi 140462.
    KEGGi hsa:140462.
    UCSCi uc004cwk.3. human. [Q96DX5-2 ]
    uc004cwl.3. human. [Q96DX5-1 ]
    uc004cwm.3. human. [Q96DX5-3 ]

    Organism-specific databases

    CTDi 140462.
    GeneCardsi GC0XM015252.
    HGNCi HGNC:17184. ASB9.
    HPAi CAB004997.
    HPA003014.
    HPA003060.
    MIMi 300890. gene.
    neXtProti NX_Q96DX5.
    PharmGKBi PA25037.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0666.
    HOGENOMi HOG000231513.
    HOVERGENi HBG001376.
    InParanoidi Q96DX5.
    KOi K10331.
    OMAi RKCFGIQ.
    OrthoDBi EOG7J447G.
    PhylomeDBi Q96DX5.
    TreeFami TF331945.

    Enzyme and pathway databases

    UniPathwayi UPA00143 .
    Reactomei REACT_75842. Antigen processing: Ubiquitination & Proteasome degradation.

    Miscellaneous databases

    EvolutionaryTracei Q96DX5.
    GenomeRNAii 140462.
    NextBioi 84125.
    PROi Q96DX5.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q96DX5.
    CleanExi HS_ASB9.
    Genevestigatori Q96DX5.

    Family and domain databases

    Gene3Di 1.25.40.20. 2 hits.
    InterProi IPR002110. Ankyrin_rpt.
    IPR020683. Ankyrin_rpt-contain_dom.
    IPR001496. SOCS_C.
    [Graphical view ]
    Pfami PF00023. Ank. 1 hit.
    PF12796. Ank_2. 1 hit.
    PF07525. SOCS_box. 1 hit.
    [Graphical view ]
    SMARTi SM00248. ANK. 6 hits.
    SM00969. SOCS_box. 1 hit.
    [Graphical view ]
    SUPFAMi SSF48403. SSF48403. 1 hit.
    PROSITEi PS50297. ANK_REP_REGION. 1 hit.
    PS50088. ANK_REPEAT. 5 hits.
    PS50225. SOCS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
      Tissue: Cervix and Skin.
    5. "ASB9 interacts with ubiquitous mitochondrial creatine kinase and inhibits mitochondrial function."
      Kwon S., Kim D., Rhee J.W., Park J.A., Kim D.W., Kim D.S., Lee Y., Kwon H.J.
      BMC Biol. 8:23-23(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    6. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. "Crystal structure of human ASB9-2 and substrate-recognition of CKB."
      Fei X., Gu X., Fan S., Yang Z., Li F., Zhang C., Gong W., Mao Y., Ji C.
      Protein J. 31:275-284(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.2 ANGSTROMS) (ISOFORM 2), FUNCTION.

    Entry informationi

    Entry nameiASB9_HUMAN
    AccessioniPrimary (citable) accession number: Q96DX5
    Secondary accession number(s): A8K8A5
    , Q9BVF5, Q9NWS5, Q9Y4T3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 28, 2003
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 121 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PATHWAY comments
      Index of metabolic and biosynthesis pathways
    4. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3