Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uncharacterized protein C10orf35

Gene

C10orf35

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at protein leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Uncharacterized protein C10orf35
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:23519. C10orf35.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei92 – 11221HelicalSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134863788.

Polymorphism and mutation databases

BioMutaiC10orf35.
DMDMi68565253.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 121121Uncharacterized protein C10orf35PRO_0000089790Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei33 – 331PhosphoserineCombined sources
Modified residuei62 – 621PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96D05.
MaxQBiQ96D05.
PaxDbiQ96D05.
PeptideAtlasiQ96D05.
PRIDEiQ96D05.
TopDownProteomicsiQ96D05-1. [Q96D05-1]
Q96D05-2. [Q96D05-2]

PTM databases

iPTMnetiQ96D05.
PhosphoSiteiQ96D05.

Expressioni

Gene expression databases

BgeeiENSG00000171224.
CleanExiHS_C10orf35.
ExpressionAtlasiQ96D05. baseline and differential.
GenevisibleiQ96D05. HS.

Organism-specific databases

HPAiHPA034591.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
SYNE4Q8N2053EBI-2548784,EBI-7131783

Protein-protein interaction databases

BioGridi128570. 21 interactions.
IntActiQ96D05. 3 interactions.
STRINGi9606.ENSP00000362376.

Structurei

3D structure databases

ProteinModelPortaliQ96D05.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410J073. Eukaryota.
ENOG410XYRT. LUCA.
GeneTreeiENSGT00390000009341.
HOGENOMiHOG000007946.
HOVERGENiHBG056578.
InParanoidiQ96D05.
OMAiNGDIVQD.
OrthoDBiEOG091G12QE.
PhylomeDBiQ96D05.
TreeFamiTF335755.

Family and domain databases

InterProiIPR027953. DUF4605.
[Graphical view]
PfamiPF15378. DUF4605. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96D05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVRILANGEI VQDDDPRVRT TTQPPRGSIP RQSFFNRGHG APPGGPGPRQ
60 70 80 90 100
QQAGARLGAA QSPFNDLNRQ LVNMGFPQWH LGNHAVEPVT SILLLFLLMM
110 120
LGVRGLLLVG LVYLVSHLSQ R
Length:121
Mass (Da):13,238
Last modified:December 1, 2001 - v1
Checksum:i6326728CAB5375C4
GO
Isoform 2 (identifier: Q96D05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRM

Show »
Length:163
Mass (Da):17,512
Checksum:iDB1F7BEA8307C5DE
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MSPVLSGIHSIYSAWVTSVN ITDCKPPSISGAAHQGPTAP GRM in isoform 2. 1 PublicationVSP_042153

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL450311 Genomic DNA. Translation: CAH72736.1.
BC013587 mRNA. Translation: AAH13587.1.
DB456046 mRNA. No translation available.
CCDSiCCDS7295.1. [Q96D05-1]
RefSeqiNP_660349.1. NM_145306.2. [Q96D05-1]
XP_005269663.1. XM_005269606.1. [Q96D05-2]
XP_005269665.1. XM_005269608.3. [Q96D05-1]
XP_011537757.1. XM_011539455.2. [Q96D05-1]
UniGeneiHs.522992.

Genome annotation databases

EnsembliENST00000373279; ENSP00000362376; ENSG00000171224. [Q96D05-1]
GeneIDi219738.
KEGGihsa:219738.
UCSCiuc001jpq.5. human. [Q96D05-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AL450311 Genomic DNA. Translation: CAH72736.1.
BC013587 mRNA. Translation: AAH13587.1.
DB456046 mRNA. No translation available.
CCDSiCCDS7295.1. [Q96D05-1]
RefSeqiNP_660349.1. NM_145306.2. [Q96D05-1]
XP_005269663.1. XM_005269606.1. [Q96D05-2]
XP_005269665.1. XM_005269608.3. [Q96D05-1]
XP_011537757.1. XM_011539455.2. [Q96D05-1]
UniGeneiHs.522992.

3D structure databases

ProteinModelPortaliQ96D05.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128570. 21 interactions.
IntActiQ96D05. 3 interactions.
STRINGi9606.ENSP00000362376.

PTM databases

iPTMnetiQ96D05.
PhosphoSiteiQ96D05.

Polymorphism and mutation databases

BioMutaiC10orf35.
DMDMi68565253.

Proteomic databases

EPDiQ96D05.
MaxQBiQ96D05.
PaxDbiQ96D05.
PeptideAtlasiQ96D05.
PRIDEiQ96D05.
TopDownProteomicsiQ96D05-1. [Q96D05-1]
Q96D05-2. [Q96D05-2]

Protocols and materials databases

DNASUi219738.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373279; ENSP00000362376; ENSG00000171224. [Q96D05-1]
GeneIDi219738.
KEGGihsa:219738.
UCSCiuc001jpq.5. human. [Q96D05-1]

Organism-specific databases

CTDi219738.
GeneCardsiC10orf35.
H-InvDBHIX0008889.
HGNCiHGNC:23519. C10orf35.
HPAiHPA034591.
neXtProtiNX_Q96D05.
PharmGKBiPA134863788.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J073. Eukaryota.
ENOG410XYRT. LUCA.
GeneTreeiENSGT00390000009341.
HOGENOMiHOG000007946.
HOVERGENiHBG056578.
InParanoidiQ96D05.
OMAiNGDIVQD.
OrthoDBiEOG091G12QE.
PhylomeDBiQ96D05.
TreeFamiTF335755.

Miscellaneous databases

GenomeRNAii219738.
PROiQ96D05.

Gene expression databases

BgeeiENSG00000171224.
CleanExiHS_C10orf35.
ExpressionAtlasiQ96D05. baseline and differential.
GenevisibleiQ96D05. HS.

Family and domain databases

InterProiIPR027953. DUF4605.
[Graphical view]
PfamiPF15378. DUF4605. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCJ035_HUMAN
AccessioniPrimary (citable) accession number: Q96D05
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 5, 2005
Last sequence update: December 1, 2001
Last modified: September 7, 2016
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.