Q96D05 (CJ035_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 66.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uncharacterized protein C10orf35 | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 121 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Subcellular location | Membrane; Single-pass membrane protein Potential. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Transmembrane Transmembrane helix |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96D05-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96D05-2) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MSPVLSGIHSIYSAWVTSVNITDCKPPSISGAAHQGPTAPGRM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 121 | 121 | Uncharacterized protein C10orf35 | PRO_0000089790 | |||||
Regions | |||||||||
| Transmembrane | 92 – 112 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 62 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 | 1 | M → MSPVLSGIHSIYSAWVTSVN ITDCKPPSISGAAHQGPTAP GRM in isoform 2. | VSP_042153 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed: 15164054] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
| [3] | Arakawa T., Carninci P., Fukuda S., Hasegawa A., Hayashida K., Hori F., Kai C., Kawai J., Kojima M., Murata M., Nakamura M., Nishiyori H., Nomura K., Ohno M., Sasaki D., Shibazaki E., Tagami M., Tagami Y., Hayashizaki Y. Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-88 (ISOFORM 2). Tissue: Testis. |
| [4] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed: 18691976] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-62, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AL450311 Genomic DNA. Translation: CAH72736.1. BC013587 mRNA. Translation: AAH13587.1. DB456046 mRNA. No translation available. |
| IPI | IPI00060546. |
| RefSeq | NP_660349.1. NM_145306.2. |
| UniGene | Hs.522992. |
3D structure databases | |
| ProteinModelPortal | Q96D05. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96D05. 1 interaction. |
PTM databases | |
| PhosphoSite | Q96D05. |
Polymorphism databases | |
| DMDM | 68565253. |
Proteomic databases | |
| PRIDE | Q96D05. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373279; ENSP00000362376; ENSG00000171224. ENST00000395055; ENSP00000378495; ENSG00000171224. |
| GeneID | 219738. |
| KEGG | hsa:219738. |
| UCSC | uc001jpq.2. human. |
Organism-specific databases | |
| CTD | 219738. |
| GeneCards | GC10P071390. |
| HGNC | HGNC:23519. C10orf35. |
| HPA | HPA034591. |
| neXtProt | NX_Q96D05. |
| PharmGKB | PA134863788. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG21400. |
| GeneTree | ENSGT00390000009341. |
| HOGENOM | HBG281539. |
| HOVERGEN | HBG056578. |
| InParanoid | Q96D05. |
| OrthoDB | EOG4DZ1WS. |
| PhylomeDB | Q96D05. |
Gene expression databases | |
| ArrayExpress | Q96D05. |
| Bgee | Q96D05. |
| CleanEx | HS_C10orf35. |
| Genevestigator | Q96D05. |
| GermOnline | ENSG00000171224. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| NextBio | 90730. |
Entry information
| Entry name | CJ035_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96D05 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |

Clusters with