Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96BY6

- DOC10_HUMAN

UniProt

Q96BY6 - DOC10_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Dedicator of cytokinesis protein 10

Gene

DOCK10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP.

GO - Molecular functioni

  1. Rho guanyl-nucleotide exchange factor activity Source: Ensembl

GO - Biological processi

  1. regulation of cell migration Source: UniProt
  2. small GTPase mediated signal transduction Source: InterPro
Complete GO annotation...

Keywords - Molecular functioni

Guanine-nucleotide releasing factor

Enzyme and pathway databases

ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
Dedicator of cytokinesis protein 10
Alternative name(s):
Zizimin-3
Gene namesi
Name:DOCK10
Synonyms:KIAA0694, ZIZ3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:23479. DOCK10.

Subcellular locationi

GO - Cellular componenti

  1. extracellular vesicular exosome Source: UniProt
  2. membrane Source: UniProtKB
Complete GO annotation...

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134983197.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 21862186Dedicator of cytokinesis protein 10PRO_0000190002Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei834 – 8341N6-acetyllysine1 Publication
Modified residuei877 – 8771PhosphoserineBy similarity
Modified residuei1232 – 12321Phosphoserine1 Publication
Modified residuei1257 – 12571PhosphoserineBy similarity
Modified residuei1292 – 12921Phosphoserine3 Publications
Modified residuei1295 – 12951Phosphoserine3 Publications
Modified residuei1318 – 13181Phosphoserine2 Publications
Modified residuei1440 – 14401Phosphothreonine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ96BY6.
PaxDbiQ96BY6.
PRIDEiQ96BY6.

PTM databases

PhosphoSiteiQ96BY6.

Expressioni

Tissue specificityi

Expressed at low level in brain and lung. Isoform 1 is enriched in normal T-cells, isoform 3 is enriched in normal B-cells and chronic lymphocytic leukemia (CLL) B-cells.2 Publications

Inductioni

Isoforms 1 and 2 are up-regulated in response to interleukin-4.1 Publication

Gene expression databases

BgeeiQ96BY6.
CleanExiHS_DOCK10.
ExpressionAtlasiQ96BY6. baseline and differential.
GenevestigatoriQ96BY6.

Organism-specific databases

HPAiHPA035749.

Interactioni

Protein-protein interaction databases

BioGridi120758. 2 interactions.
IntActiQ96BY6. 1 interaction.
STRINGi9606.ENSP00000258390.

Structurei

3D structure databases

ProteinModelPortaliQ96BY6.
SMRiQ96BY6. Positions 181-302, 1694-2149.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini181 – 290110PHPROSITE-ProRule annotationAdd
BLAST
Domaini672 – 850179DHR-1Add
BLAST
Domaini1690 – 2150461DHR-2Add
BLAST

Domaini

The DHR-2 domain may mediate some GEF activity.By similarity

Sequence similaritiesi

Belongs to the DOCK family.Curated
Contains 1 DHR-1 domain.Curated
Contains 1 DHR-2 domain.Curated
Contains 1 PH domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG242127.
GeneTreeiENSGT00760000119234.
HOGENOMiHOG000231373.
HOVERGENiHBG107819.
InParanoidiQ96BY6.
OMAiCQYKFDF.
OrthoDBiEOG76DTRQ.
PhylomeDBiQ96BY6.
TreeFamiTF313629.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view]
PANTHERiPTHR23317. PTHR23317. 1 hit.
PfamiPF06920. Ded_cyto. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
PF00169. PH. 1 hit.
[Graphical view]
SMARTiSM00233. PH. 1 hit.
[Graphical view]
PROSITEiPS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96BY6-1) [UniParc]FASTAAdd to Basket

Also known as: DOCK10.1

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGERTRRFT RSLLRPGQAA ELRHSAASAA AVAVSSRQQQ RQEKPRLLEP
60 70 80 90 100
LDYETVIEEL EKTYRNDPLQ DLLFFPSDDF SAATVSWDIR TLYSTVPEDA
110 120 130 140 150
EHKAENLLVK EACKFYSSQW HVVNYKYEQY SGDIRQLPRA EYKPEKLPSH
160 170 180 190 200
SFEIDHEDAD KDEDTTSHSS SKGGGGAGGT GVFKSGWLYK GNFNSTVNNT
210 220 230 240 250
VTVRSFKKRY FQLTQLPDNS YIMNFYKDEK ISKEPKGCIF LDSCTGVVQN
260 270 280 290 300
NRLRKYAFEL KMNDLTYFVL AAETESDMDE WIHTLNRILQ ISPEGPLQGR
310 320 330 340 350
RSTELTDLGL DSLDNSVTCE CTPEETDSSE NNLHADFAKY LTETEDTVKT
360 370 380 390 400
TRNMERLNLF SLDPDIDTLK LQKKDLLEPE SVIKPFEEKA AKRIMIICKA
410 420 430 440 450
LNSNLQGCVT ENENDPITNI EPFFVSVALY DLRDSRKISA DFHVDLNHAA
460 470 480 490 500
VRQMLLGASV ALENGNIDTI TPRQSEEPHI KGLPEEWLKF PKQAVFSVSN
510 520 530 540 550
PHSEIVLVAK IEKVLMGNIA SGAEPYIKNP DSNKYAQKIL KSNRQFCSKL
560 570 580 590 600
GKYRMPFAWA VRSVFKDNQG NVDRDSRFSP LFRQESSKIS TEDLVKLVSD
610 620 630 640 650
YRRADRISKM QTIPGSLDIA VDNVPLEHPN CVTSSFIPVK PFNMMAQTEP
660 670 680 690 700
TVEVEEFVYD STKYCRPYRV YKNQIYIYPK HLKYDSQKCF NKARNITVCI
710 720 730 740 750
EFKNSDEESA KPLKCIYGKP GGPLFTSAAY TAVLHHSQNP DFSDEVKIEL
760 770 780 790 800
PTQLHEKHHI LFSFYHVTCD INAKANAKKK EALETSVGYA WLPLMKHDQI
810 820 830 840 850
ASQEYNIPIA TSLPPNYLSF QDSASGKHGG SDIKWVDGGK PLFKVSTFVV
860 870 880 890 900
STVNTQDPHV NAFFQECQKR EKDMSQSPTS NFIRSCKNLL NVEKIHAIMS
910 920 930 940 950
FLPIILNQLF KVLVQNEEDE ITTTVTRVLT DIVAKCHEEQ LDHSVQSYIK
960 970 980 990 1000
FVFKTRACKE RTVHEELAKN VTGLLKSNDS TTVKHVLKHS WFFFAIILKS
1010 1020 1030 1040 1050
MAQHLIDTNK IQLPRPQRFP ESYQNELDNL VMVLSDHVIW KYKDALEETR
1060 1070 1080 1090 1100
RANHSVARFL KRCFTFMDRG YVFKMVNNYI SMFSSGDLKT LCQYKFDFLQ
1110 1120 1130 1140 1150
EVCQHEHFIP LCLPIRSANI PDPLTPSEST QELHASDMPE YSVTNEFCRK
1160 1170 1180 1190 1200
HFLIGILLRE VGFALQEDQD VRHLALAVLK NLMAKHSFDD RYREPRKQAQ
1210 1220 1230 1240 1250
IASLYMPLYG MLLDNMPRIY LKDLYPFTVN TSNQGSRDDL STNGGFQSQT
1260 1270 1280 1290 1300
AIKHANSVDT SFSKDVLNSI AAFSSIAIST VNHADSRASL ASLDSNPSTN
1310 1320 1330 1340 1350
EKSSEKTDNC EKIPRPLSLI GSTLRFDKLD QAETRSLLMC FLHIMKTISY
1360 1370 1380 1390 1400
ETLIAYWQRA PSPEVSDFFS ILDVCLQNFR YLGKRNIIRK IAAAFKFVQS
1410 1420 1430 1440 1450
TQNNGTLKGS NPSCQTSGLL SQWMHSTSSH EGHKQHRSQT LPIIRGKNAL
1460 1470 1480 1490 1500
SNPKLLQMLD NTMTSNSNEI DIVHHVDTEA NIATEVCLTI LDLLSLFTQT
1510 1520 1530 1540 1550
HQRQLQQCDC QNSLMKRVFD TYMLFFQVNQ SATALKHVFA SLRLFVCKFP
1560 1570 1580 1590 1600
SAFFQGPADL CGSFCYEVLK CCNHRSRSTQ TEASALLYFF MRKNFEFNKQ
1610 1620 1630 1640 1650
KSIVRSHLQL IKAVSQLIAD AGIGGSRFQH SLAITNNFAN GDKQMKNSNF
1660 1670 1680 1690 1700
PAEVKDLTKR IRTVLMATAQ MKEHEKDPEM LVDLQYSLAN SYASTPELRR
1710 1720 1730 1740 1750
TWLESMAKIH ARNGDLSEAA MCYIHIAALI AEYLKRKGYW KVEKICTASL
1760 1770 1780 1790 1800
LSEDTHPCDS NSLLTTPSGG SMFSMGWPAF LSITPNIKEE GAMKEDSGMQ
1810 1820 1830 1840 1850
DTPYNENILV EQLYMCVEFL WKSERYELIA DVNKPIIAVF EKQRDFKKLS
1860 1870 1880 1890 1900
DLYYDIHRSY LKVAEVVNSE KRLFGRYYRV AFYGQGFFEE EEGKEYIYKE
1910 1920 1930 1940 1950
PKLTGLSEIS QRLLKLYADK FGADNVKIIQ DSNKVNPKDL DPKYAYIQVT
1960 1970 1980 1990 2000
YVTPFFEEKE IEDRKTDFEM HHNINRFVFE TPFTLSGKKH GGVAEQCKRR
2010 2020 2030 2040 2050
TILTTSHLFP YVKKRIQVIS QSSTELNPIE VAIDEMSKKV SELNQLCTME
2060 2070 2080 2090 2100
EVDMIRLQLK LQGSVSVKVN AGPMAYARAF LEETNAKKYP DNQVKLLKEI
2110 2120 2130 2140 2150
FRQFADACGQ ALDVNERLIK EDQLEYQEEL RSHYKDMLSE LSTVMNEQIT
2160 2170 2180
GRDDLSKRGV DQTCTRVISK ATPALPTVSI SSSAEV

Note: No experimental confirmation available.

Length:2,186
Mass (Da):249,531
Last modified:May 3, 2011 - v3
Checksum:i955ABC03DE2270AF
GO
Isoform 2 (identifier: Q96BY6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     565-593: FKDNQGNVDRDSRFSPLFRQESSKISTED → DSCSQQTRNTFNGGIGSFSFERFCVAYYF
     594-2186: Missing.

Note: No experimental confirmation available.

Show »
Length:593
Mass (Da):67,378
Checksum:i4C41C48C2162ADB0
GO
Isoform 3 (identifier: Q96BY6-3) [UniParc]FASTAAdd to Basket

Also known as: DOCK10.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-41: MAGERTRRFT...VAVSSRQQQR → MSFRGKVFKREPSEFWKKRRTVRRVNQEEIHRFSS

Show »
Length:2,180
Mass (Da):249,491
Checksum:iE4A9EA93C9537982
GO

Sequence cautioni

The sequence BAA91022.1 differs from that shown. Reason: Frameshift at position 2133.
The sequence AAH15018.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAA31669.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAA91583.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti563 – 5631S → Y in BAA31669. (PubMed:9734811)Curated
Sequence conflicti1833 – 18331N → D in BAA91583. (PubMed:14702039)Curated
Sequence conflicti1966 – 19661T → S in BAA91022. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4141MAGER…RQQQR → MSFRGKVFKREPSEFWKKRR TVRRVNQEEIHRFSS in isoform 3. 1 PublicationVSP_047731Add
BLAST
Alternative sequencei565 – 59329FKDNQ…ISTED → DSCSQQTRNTFNGGIGSFSF ERFCVAYYF in isoform 2. 1 PublicationVSP_007716Add
BLAST
Alternative sequencei594 – 21861593Missing in isoform 2. 1 PublicationVSP_007717Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB014594 mRNA. Translation: BAA31669.2. Different initiation.
EU236710 mRNA. Translation: ABY70713.2.
AC011739 Genomic DNA. No translation available.
AC017095 Genomic DNA. No translation available.
AC093806 Genomic DNA. No translation available.
BC015018 mRNA. Translation: AAH15018.1. Different initiation.
AK000227 mRNA. Translation: BAA91022.1. Frameshift.
AK001253 mRNA. Translation: BAA91583.1. Different initiation.
CCDSiCCDS46528.1. [Q96BY6-1]
CCDS74661.1. [Q96BY6-3]
RefSeqiNP_001277192.1. NM_001290263.1. [Q96BY6-3]
NP_055504.2. NM_014689.2. [Q96BY6-1]
UniGeneiHs.46578.

Genome annotation databases

EnsembliENST00000258390; ENSP00000258390; ENSG00000135905. [Q96BY6-1]
ENST00000409592; ENSP00000386694; ENSG00000135905. [Q96BY6-3]
GeneIDi55619.
KEGGihsa:55619.
UCSCiuc002vod.1. human. [Q96BY6-2]
uc010fwz.1. human. [Q96BY6-1]

Polymorphism databases

DMDMi332278210.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB014594 mRNA. Translation: BAA31669.2 . Different initiation.
EU236710 mRNA. Translation: ABY70713.2 .
AC011739 Genomic DNA. No translation available.
AC017095 Genomic DNA. No translation available.
AC093806 Genomic DNA. No translation available.
BC015018 mRNA. Translation: AAH15018.1 . Different initiation.
AK000227 mRNA. Translation: BAA91022.1 . Frameshift.
AK001253 mRNA. Translation: BAA91583.1 . Different initiation.
CCDSi CCDS46528.1. [Q96BY6-1 ]
CCDS74661.1. [Q96BY6-3 ]
RefSeqi NP_001277192.1. NM_001290263.1. [Q96BY6-3 ]
NP_055504.2. NM_014689.2. [Q96BY6-1 ]
UniGenei Hs.46578.

3D structure databases

ProteinModelPortali Q96BY6.
SMRi Q96BY6. Positions 181-302, 1694-2149.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120758. 2 interactions.
IntActi Q96BY6. 1 interaction.
STRINGi 9606.ENSP00000258390.

PTM databases

PhosphoSitei Q96BY6.

Polymorphism databases

DMDMi 332278210.

Proteomic databases

MaxQBi Q96BY6.
PaxDbi Q96BY6.
PRIDEi Q96BY6.

Protocols and materials databases

DNASUi 55619.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000258390 ; ENSP00000258390 ; ENSG00000135905 . [Q96BY6-1 ]
ENST00000409592 ; ENSP00000386694 ; ENSG00000135905 . [Q96BY6-3 ]
GeneIDi 55619.
KEGGi hsa:55619.
UCSCi uc002vod.1. human. [Q96BY6-2 ]
uc010fwz.1. human. [Q96BY6-1 ]

Organism-specific databases

CTDi 55619.
GeneCardsi GC02M225593.
H-InvDB HIX0002889.
HGNCi HGNC:23479. DOCK10.
HPAi HPA035749.
MIMi 611518. gene.
neXtProti NX_Q96BY6.
PharmGKBi PA134983197.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG242127.
GeneTreei ENSGT00760000119234.
HOGENOMi HOG000231373.
HOVERGENi HBG107819.
InParanoidi Q96BY6.
OMAi CQYKFDF.
OrthoDBi EOG76DTRQ.
PhylomeDBi Q96BY6.
TreeFami TF313629.

Enzyme and pathway databases

Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

ChiTaRSi DOCK10. human.
GeneWikii Dock10.
GenomeRNAii 55619.
NextBioi 35468744.
PROi Q96BY6.
SOURCEi Search...

Gene expression databases

Bgeei Q96BY6.
CleanExi HS_DOCK10.
ExpressionAtlasi Q96BY6. baseline and differential.
Genevestigatori Q96BY6.

Family and domain databases

Gene3Di 2.30.29.30. 1 hit.
InterProi IPR027007. DHR-1_domain.
IPR027357. DHR-2.
IPR026791. DOCK.
IPR010703. DOCK_C.
IPR021816. DOCK_C/D_N.
IPR001849. PH_domain.
IPR011993. PH_like_dom.
[Graphical view ]
PANTHERi PTHR23317. PTHR23317. 1 hit.
Pfami PF06920. Ded_cyto. 1 hit.
PF14429. DOCK-C2. 1 hit.
PF11878. DUF3398. 1 hit.
PF00169. PH. 1 hit.
[Graphical view ]
SMARTi SM00233. PH. 1 hit.
[Graphical view ]
PROSITEi PS51650. DHR_1. 1 hit.
PS51651. DHR_2. 1 hit.
PS50003. PH_DOMAIN. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Brain.
  2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
    Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
    DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: SEQUENCE REVISION.
  3. "Human and mouse DOCK10 splicing isoforms with alternative first coding exon usage are differentially expressed in T and B lymphocytes."
    Alcaraz-Garcia M.J., Ruiz-Lafuente N., Sebastian-Ruiz S., Majado M.J., Gonzalez-Garcia C., Bernardo M.V., Alvarez-Lopez M.R., Parrado A.
    Hum. Immunol. 72:531-537(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INDUCTION, TISSUE SPECIFICITY.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1599-2186 (ISOFORM 1).
    Tissue: Skin.
  6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1599-2186 (ISOFORM 1).
    Tissue: Colon mucosa and Teratocarcinoma.
  7. "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity."
    Cote J.-F., Vuori K.
    J. Cell Sci. 115:4901-4913(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NOMENCLATURE.
  8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1292; SER-1295 AND SER-1318, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1292 AND SER-1295, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Platelet.
  10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1232; SER-1292; SER-1295; SER-1318 AND THR-1440, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  11. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-834, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiDOC10_HUMAN
AccessioniPrimary (citable) accession number: Q96BY6
Secondary accession number(s): B3FL70
, O75178, Q9NW06, Q9NXI8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 3, 2003
Last sequence update: May 3, 2011
Last modified: October 29, 2014
This is version 123 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3