Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96BY6

- DOC10_HUMAN

UniProt

Q96BY6 - DOC10_HUMAN

Protein

Dedicator of cytokinesis protein 10

Gene

DOCK10

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 122 (01 Oct 2014)
      Sequence version 3 (03 May 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Potential guanine nucleotide exchange factor (GEF). GEF proteins activate some small GTPases by exchanging bound GDP for free GTP.

    GO - Molecular functioni

    1. Rho guanyl-nucleotide exchange factor activity Source: Ensembl

    GO - Biological processi

    1. regulation of cell migration Source: UniProt
    2. small GTPase mediated signal transduction Source: InterPro

    Keywords - Molecular functioni

    Guanine-nucleotide releasing factor

    Enzyme and pathway databases

    ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dedicator of cytokinesis protein 10
    Alternative name(s):
    Zizimin-3
    Gene namesi
    Name:DOCK10
    Synonyms:KIAA0694, ZIZ3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:23479. DOCK10.

    Subcellular locationi

    GO - Cellular componenti

    1. extracellular vesicular exosome Source: UniProt
    2. membrane Source: UniProtKB

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134983197.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 21862186Dedicator of cytokinesis protein 10PRO_0000190002Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei834 – 8341N6-acetyllysine1 Publication
    Modified residuei877 – 8771PhosphoserineBy similarity
    Modified residuei1232 – 12321Phosphoserine1 Publication
    Modified residuei1257 – 12571PhosphoserineBy similarity
    Modified residuei1292 – 12921Phosphoserine3 Publications
    Modified residuei1295 – 12951Phosphoserine3 Publications
    Modified residuei1318 – 13181Phosphoserine2 Publications
    Modified residuei1440 – 14401Phosphothreonine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ96BY6.
    PaxDbiQ96BY6.
    PRIDEiQ96BY6.

    PTM databases

    PhosphoSiteiQ96BY6.

    Expressioni

    Tissue specificityi

    Expressed at low level in brain and lung. Isoform 1 is enriched in normal T-cells, isoform 3 is enriched in normal B-cells and chronic lymphocytic leukemia (CLL) B-cells.2 Publications

    Inductioni

    Isoforms 1 and 2 are up-regulated in response to interleukin-4.1 Publication

    Gene expression databases

    ArrayExpressiQ96BY6.
    BgeeiQ96BY6.
    CleanExiHS_DOCK10.
    GenevestigatoriQ96BY6.

    Organism-specific databases

    HPAiHPA035749.

    Interactioni

    Protein-protein interaction databases

    BioGridi120758. 2 interactions.
    IntActiQ96BY6. 1 interaction.
    STRINGi9606.ENSP00000258390.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96BY6.
    SMRiQ96BY6. Positions 181-302, 1694-2149.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini181 – 290110PHPROSITE-ProRule annotationAdd
    BLAST
    Domaini672 – 850179DHR-1Add
    BLAST
    Domaini1690 – 2150461DHR-2Add
    BLAST

    Domaini

    The DHR-2 domain may mediate some GEF activity.By similarity

    Sequence similaritiesi

    Belongs to the DOCK family.Curated
    Contains 1 DHR-1 domain.Curated
    Contains 1 DHR-2 domain.Curated
    Contains 1 PH domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG242127.
    HOGENOMiHOG000231373.
    HOVERGENiHBG107819.
    OMAiCQYKFDF.
    OrthoDBiEOG76DTRQ.
    PhylomeDBiQ96BY6.
    TreeFamiTF313629.

    Family and domain databases

    Gene3Di2.30.29.30. 1 hit.
    InterProiIPR027007. DHR-1_domain.
    IPR027357. DHR-2.
    IPR026791. DOCK.
    IPR010703. DOCK_C.
    IPR021816. DOCK_C/D_N.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    [Graphical view]
    PANTHERiPTHR23317. PTHR23317. 1 hit.
    PfamiPF06920. Ded_cyto. 1 hit.
    PF14429. DOCK-C2. 1 hit.
    PF11878. DUF3398. 1 hit.
    PF00169. PH. 1 hit.
    [Graphical view]
    SMARTiSM00233. PH. 1 hit.
    [Graphical view]
    PROSITEiPS51650. DHR_1. 1 hit.
    PS51651. DHR_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96BY6-1) [UniParc]FASTAAdd to Basket

    Also known as: DOCK10.1

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAGERTRRFT RSLLRPGQAA ELRHSAASAA AVAVSSRQQQ RQEKPRLLEP     50
    LDYETVIEEL EKTYRNDPLQ DLLFFPSDDF SAATVSWDIR TLYSTVPEDA 100
    EHKAENLLVK EACKFYSSQW HVVNYKYEQY SGDIRQLPRA EYKPEKLPSH 150
    SFEIDHEDAD KDEDTTSHSS SKGGGGAGGT GVFKSGWLYK GNFNSTVNNT 200
    VTVRSFKKRY FQLTQLPDNS YIMNFYKDEK ISKEPKGCIF LDSCTGVVQN 250
    NRLRKYAFEL KMNDLTYFVL AAETESDMDE WIHTLNRILQ ISPEGPLQGR 300
    RSTELTDLGL DSLDNSVTCE CTPEETDSSE NNLHADFAKY LTETEDTVKT 350
    TRNMERLNLF SLDPDIDTLK LQKKDLLEPE SVIKPFEEKA AKRIMIICKA 400
    LNSNLQGCVT ENENDPITNI EPFFVSVALY DLRDSRKISA DFHVDLNHAA 450
    VRQMLLGASV ALENGNIDTI TPRQSEEPHI KGLPEEWLKF PKQAVFSVSN 500
    PHSEIVLVAK IEKVLMGNIA SGAEPYIKNP DSNKYAQKIL KSNRQFCSKL 550
    GKYRMPFAWA VRSVFKDNQG NVDRDSRFSP LFRQESSKIS TEDLVKLVSD 600
    YRRADRISKM QTIPGSLDIA VDNVPLEHPN CVTSSFIPVK PFNMMAQTEP 650
    TVEVEEFVYD STKYCRPYRV YKNQIYIYPK HLKYDSQKCF NKARNITVCI 700
    EFKNSDEESA KPLKCIYGKP GGPLFTSAAY TAVLHHSQNP DFSDEVKIEL 750
    PTQLHEKHHI LFSFYHVTCD INAKANAKKK EALETSVGYA WLPLMKHDQI 800
    ASQEYNIPIA TSLPPNYLSF QDSASGKHGG SDIKWVDGGK PLFKVSTFVV 850
    STVNTQDPHV NAFFQECQKR EKDMSQSPTS NFIRSCKNLL NVEKIHAIMS 900
    FLPIILNQLF KVLVQNEEDE ITTTVTRVLT DIVAKCHEEQ LDHSVQSYIK 950
    FVFKTRACKE RTVHEELAKN VTGLLKSNDS TTVKHVLKHS WFFFAIILKS 1000
    MAQHLIDTNK IQLPRPQRFP ESYQNELDNL VMVLSDHVIW KYKDALEETR 1050
    RANHSVARFL KRCFTFMDRG YVFKMVNNYI SMFSSGDLKT LCQYKFDFLQ 1100
    EVCQHEHFIP LCLPIRSANI PDPLTPSEST QELHASDMPE YSVTNEFCRK 1150
    HFLIGILLRE VGFALQEDQD VRHLALAVLK NLMAKHSFDD RYREPRKQAQ 1200
    IASLYMPLYG MLLDNMPRIY LKDLYPFTVN TSNQGSRDDL STNGGFQSQT 1250
    AIKHANSVDT SFSKDVLNSI AAFSSIAIST VNHADSRASL ASLDSNPSTN 1300
    EKSSEKTDNC EKIPRPLSLI GSTLRFDKLD QAETRSLLMC FLHIMKTISY 1350
    ETLIAYWQRA PSPEVSDFFS ILDVCLQNFR YLGKRNIIRK IAAAFKFVQS 1400
    TQNNGTLKGS NPSCQTSGLL SQWMHSTSSH EGHKQHRSQT LPIIRGKNAL 1450
    SNPKLLQMLD NTMTSNSNEI DIVHHVDTEA NIATEVCLTI LDLLSLFTQT 1500
    HQRQLQQCDC QNSLMKRVFD TYMLFFQVNQ SATALKHVFA SLRLFVCKFP 1550
    SAFFQGPADL CGSFCYEVLK CCNHRSRSTQ TEASALLYFF MRKNFEFNKQ 1600
    KSIVRSHLQL IKAVSQLIAD AGIGGSRFQH SLAITNNFAN GDKQMKNSNF 1650
    PAEVKDLTKR IRTVLMATAQ MKEHEKDPEM LVDLQYSLAN SYASTPELRR 1700
    TWLESMAKIH ARNGDLSEAA MCYIHIAALI AEYLKRKGYW KVEKICTASL 1750
    LSEDTHPCDS NSLLTTPSGG SMFSMGWPAF LSITPNIKEE GAMKEDSGMQ 1800
    DTPYNENILV EQLYMCVEFL WKSERYELIA DVNKPIIAVF EKQRDFKKLS 1850
    DLYYDIHRSY LKVAEVVNSE KRLFGRYYRV AFYGQGFFEE EEGKEYIYKE 1900
    PKLTGLSEIS QRLLKLYADK FGADNVKIIQ DSNKVNPKDL DPKYAYIQVT 1950
    YVTPFFEEKE IEDRKTDFEM HHNINRFVFE TPFTLSGKKH GGVAEQCKRR 2000
    TILTTSHLFP YVKKRIQVIS QSSTELNPIE VAIDEMSKKV SELNQLCTME 2050
    EVDMIRLQLK LQGSVSVKVN AGPMAYARAF LEETNAKKYP DNQVKLLKEI 2100
    FRQFADACGQ ALDVNERLIK EDQLEYQEEL RSHYKDMLSE LSTVMNEQIT 2150
    GRDDLSKRGV DQTCTRVISK ATPALPTVSI SSSAEV 2186

    Note: No experimental confirmation available.

    Length:2,186
    Mass (Da):249,531
    Last modified:May 3, 2011 - v3
    Checksum:i955ABC03DE2270AF
    GO
    Isoform 2 (identifier: Q96BY6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         565-593: FKDNQGNVDRDSRFSPLFRQESSKISTED → DSCSQQTRNTFNGGIGSFSFERFCVAYYF
         594-2186: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:593
    Mass (Da):67,378
    Checksum:i4C41C48C2162ADB0
    GO
    Isoform 3 (identifier: Q96BY6-3) [UniParc]FASTAAdd to Basket

    Also known as: DOCK10.2

    The sequence of this isoform differs from the canonical sequence as follows:
         1-41: MAGERTRRFT...VAVSSRQQQR → MSFRGKVFKREPSEFWKKRRTVRRVNQEEIHRFSS

    Show »
    Length:2,180
    Mass (Da):249,491
    Checksum:iE4A9EA93C9537982
    GO

    Sequence cautioni

    The sequence BAA91022.1 differs from that shown. Reason: Frameshift at position 2133.
    The sequence AAH15018.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
    The sequence BAA31669.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAA91583.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti563 – 5631S → Y in BAA31669. (PubMed:9734811)Curated
    Sequence conflicti1833 – 18331N → D in BAA91583. (PubMed:14702039)Curated
    Sequence conflicti1966 – 19661T → S in BAA91022. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4141MAGER…RQQQR → MSFRGKVFKREPSEFWKKRR TVRRVNQEEIHRFSS in isoform 3. 1 PublicationVSP_047731Add
    BLAST
    Alternative sequencei565 – 59329FKDNQ…ISTED → DSCSQQTRNTFNGGIGSFSF ERFCVAYYF in isoform 2. 1 PublicationVSP_007716Add
    BLAST
    Alternative sequencei594 – 21861593Missing in isoform 2. 1 PublicationVSP_007717Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB014594 mRNA. Translation: BAA31669.2. Different initiation.
    EU236710 mRNA. Translation: ABY70713.2.
    AC011739 Genomic DNA. No translation available.
    AC017095 Genomic DNA. No translation available.
    AC093806 Genomic DNA. No translation available.
    BC015018 mRNA. Translation: AAH15018.1. Different initiation.
    AK000227 mRNA. Translation: BAA91022.1. Frameshift.
    AK001253 mRNA. Translation: BAA91583.1. Different initiation.
    CCDSiCCDS46528.1. [Q96BY6-1]
    RefSeqiNP_001277192.1. NM_001290263.1. [Q96BY6-3]
    NP_055504.2. NM_014689.2. [Q96BY6-1]
    UniGeneiHs.46578.

    Genome annotation databases

    EnsembliENST00000258390; ENSP00000258390; ENSG00000135905. [Q96BY6-1]
    ENST00000409592; ENSP00000386694; ENSG00000135905. [Q96BY6-3]
    GeneIDi55619.
    KEGGihsa:55619.
    UCSCiuc002vod.1. human. [Q96BY6-2]
    uc010fwz.1. human. [Q96BY6-1]

    Polymorphism databases

    DMDMi332278210.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB014594 mRNA. Translation: BAA31669.2 . Different initiation.
    EU236710 mRNA. Translation: ABY70713.2 .
    AC011739 Genomic DNA. No translation available.
    AC017095 Genomic DNA. No translation available.
    AC093806 Genomic DNA. No translation available.
    BC015018 mRNA. Translation: AAH15018.1 . Different initiation.
    AK000227 mRNA. Translation: BAA91022.1 . Frameshift.
    AK001253 mRNA. Translation: BAA91583.1 . Different initiation.
    CCDSi CCDS46528.1. [Q96BY6-1 ]
    RefSeqi NP_001277192.1. NM_001290263.1. [Q96BY6-3 ]
    NP_055504.2. NM_014689.2. [Q96BY6-1 ]
    UniGenei Hs.46578.

    3D structure databases

    ProteinModelPortali Q96BY6.
    SMRi Q96BY6. Positions 181-302, 1694-2149.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120758. 2 interactions.
    IntActi Q96BY6. 1 interaction.
    STRINGi 9606.ENSP00000258390.

    PTM databases

    PhosphoSitei Q96BY6.

    Polymorphism databases

    DMDMi 332278210.

    Proteomic databases

    MaxQBi Q96BY6.
    PaxDbi Q96BY6.
    PRIDEi Q96BY6.

    Protocols and materials databases

    DNASUi 55619.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000258390 ; ENSP00000258390 ; ENSG00000135905 . [Q96BY6-1 ]
    ENST00000409592 ; ENSP00000386694 ; ENSG00000135905 . [Q96BY6-3 ]
    GeneIDi 55619.
    KEGGi hsa:55619.
    UCSCi uc002vod.1. human. [Q96BY6-2 ]
    uc010fwz.1. human. [Q96BY6-1 ]

    Organism-specific databases

    CTDi 55619.
    GeneCardsi GC02M225593.
    H-InvDB HIX0002889.
    HGNCi HGNC:23479. DOCK10.
    HPAi HPA035749.
    MIMi 611518. gene.
    neXtProti NX_Q96BY6.
    PharmGKBi PA134983197.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG242127.
    HOGENOMi HOG000231373.
    HOVERGENi HBG107819.
    OMAi CQYKFDF.
    OrthoDBi EOG76DTRQ.
    PhylomeDBi Q96BY6.
    TreeFami TF313629.

    Enzyme and pathway databases

    Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

    Miscellaneous databases

    ChiTaRSi DOCK10. human.
    GeneWikii Dock10.
    GenomeRNAii 55619.
    NextBioi 35468744.
    PROi Q96BY6.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96BY6.
    Bgeei Q96BY6.
    CleanExi HS_DOCK10.
    Genevestigatori Q96BY6.

    Family and domain databases

    Gene3Di 2.30.29.30. 1 hit.
    InterProi IPR027007. DHR-1_domain.
    IPR027357. DHR-2.
    IPR026791. DOCK.
    IPR010703. DOCK_C.
    IPR021816. DOCK_C/D_N.
    IPR001849. PH_domain.
    IPR011993. PH_like_dom.
    [Graphical view ]
    PANTHERi PTHR23317. PTHR23317. 1 hit.
    Pfami PF06920. Ded_cyto. 1 hit.
    PF14429. DOCK-C2. 1 hit.
    PF11878. DUF3398. 1 hit.
    PF00169. PH. 1 hit.
    [Graphical view ]
    SMARTi SM00233. PH. 1 hit.
    [Graphical view ]
    PROSITEi PS51650. DHR_1. 1 hit.
    PS51651. DHR_2. 1 hit.
    PS50003. PH_DOMAIN. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Prediction of the coding sequences of unidentified human genes. X. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Ishikawa K., Nagase T., Suyama M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:169-176(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: Brain.
    2. "Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones."
      Nakajima D., Okazaki N., Yamakawa H., Kikuno R., Ohara O., Nagase T.
      DNA Res. 9:99-106(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: SEQUENCE REVISION.
    3. "Human and mouse DOCK10 splicing isoforms with alternative first coding exon usage are differentially expressed in T and B lymphocytes."
      Alcaraz-Garcia M.J., Ruiz-Lafuente N., Sebastian-Ruiz S., Majado M.J., Gonzalez-Garcia C., Bernardo M.V., Alvarez-Lopez M.R., Parrado A.
      Hum. Immunol. 72:531-537(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INDUCTION, TISSUE SPECIFICITY.
    4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
      Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
      , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
      Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1599-2186 (ISOFORM 1).
      Tissue: Skin.
    6. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1599-2186 (ISOFORM 1).
      Tissue: Colon mucosa and Teratocarcinoma.
    7. "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity."
      Cote J.-F., Vuori K.
      J. Cell Sci. 115:4901-4913(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NOMENCLATURE.
    8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1292; SER-1295 AND SER-1318, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1292 AND SER-1295, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Platelet.
    10. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1232; SER-1292; SER-1295; SER-1318 AND THR-1440, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    11. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
      Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
      Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-834, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiDOC10_HUMAN
    AccessioniPrimary (citable) accession number: Q96BY6
    Secondary accession number(s): B3FL70
    , O75178, Q9NW06, Q9NXI8
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: July 3, 2003
    Last sequence update: May 3, 2011
    Last modified: October 1, 2014
    This is version 122 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3