Q96BW1 (UPP_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 86.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Uracil phosphoribosyltransferase homolog | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 309 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | |
| Tissue specificity | Highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle. Ref.1 |
| Sequence similarities | Belongs to the UPRTase family. |
| Caution | No UPRTase activity has been detected in vitro (Ref.1) and the uracil binding region known from UPRTases is missing. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | UMP biosynthetic process Inferred from electronic annotation. Source: Compara female pregnancyInferred from electronic annotation. Source: Compara lactationInferred from electronic annotation. Source: Compara response to insulin stimulusInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96BW1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96BW1-2) The sequence of this isoform differs from the canonical sequence as follows: 144-176: IRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFE → VLPEDLFQKSIDNSCSAFHHQTCCGRGIESAAI 177-309: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q96BW1-3) The sequence of this isoform differs from the canonical sequence as follows: 1-114: Missing. 276-281: AKSIIQ → EFSMRQ 282-309: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 309 | 309 | Uracil phosphoribosyltransferase homolog | PRO_0000254535 | |||||
Natural variations | |||||||||
| Alternative sequence | 1 – 114 | 114 | Missing in isoform 3. | VSP_021205 | |||||
| Alternative sequence | 144 – 176 | 33 | IRLVV…GVKFE → VLPEDLFQKSIDNSCSAFHH QTCCGRGIESAAI in isoform 2. | VSP_021206 | |||||
| Alternative sequence | 177 – 309 | 133 | Missing in isoform 2. | VSP_021207 | |||||
| Alternative sequence | 276 – 281 | 6 | AKSIIQ → EFSMRQ in isoform 3. | VSP_021208 | |||||
| Alternative sequence | 282 – 309 | 28 | Missing in isoform 3. | VSP_021209 | |||||
Experimental info | |||||||||
| Sequence conflict | 130 | 1 | T → A in CAH18190. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK056354 mRNA. No translation available. CR749336 mRNA. Translation: CAH18190.1. AL590234, AL137013 Genomic DNA. Translation: CAI39681.1. AL590234, AL137013 Genomic DNA. Translation: CAI39682.1. AL137013, AL590234 Genomic DNA. Translation: CAI40088.1. AL137013, AL590234 Genomic DNA. Translation: CAI40089.1. BC015116 mRNA. Translation: AAH15116.1. |
| IPI | IPI00642494. IPI00643178. IPI00797517. |
| RefSeq | NP_659489.1. NM_145052.3. |
| UniGene | Hs.91612. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1JLS based on UniProtKB Q26998. |
| ProteinModelPortal | Q96BW1. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96BW1. 1 interaction. |
| MINT | MINT-1476786. |
| STRING | 9606.ENSP00000362481. |
PTM databases | |
| PhosphoSite | Q96BW1. |
Polymorphism databases | |
| DMDM | 74751783. |
Proteomic databases | |
| PaxDb | Q96BW1. |
| PRIDE | Q96BW1. |
Protocols and materials databases | |
| DNASU | 139596. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000373379; ENSP00000362477; ENSG00000094841. ENST00000373383; ENSP00000362481; ENSG00000094841. ENST00000462237; ENSP00000433987; ENSG00000094841. |
| GeneID | 139596. |
| KEGG | hsa:139596. |
| UCSC | uc004ecb.2. human. |
Organism-specific databases | |
| CTD | 139596. |
| GeneCards | GC0XP074493. |
| H-InvDB | HIX0016881. |
| HGNC | HGNC:28334. UPRT. |
| HPA | HPA000805. |
| MIM | 300656. gene. |
| neXtProt | NX_Q96BW1. |
| PharmGKB | PA162408652. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | COG0035. |
| HOGENOM | HOG000262755. |
| HOVERGEN | HBG105296. |
| InParanoid | Q96BW1. |
| KO | K00761. |
| OMA | DFKFYAD. |
| OrthoDB | EOG44TP8D. |
Gene expression databases | |
| ArrayExpress | Q96BW1. |
| Bgee | Q96BW1. |
| CleanEx | HS_UPRT. |
| Genevestigator | Q96BW1. |
| GermOnline | ENSG00000094841. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 139596. |
| NextBio | 83994. |
| SOURCE | Search... |
Entry information
| Entry name | UPP_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96BW1 Secondary accession number(s): Q5JRL1 Q96MW2 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
