Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Uracil phosphoribosyltransferase homolog

Gene

UPRT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Binding sitei133GTPBy similarity1
Binding sitei142GTPBy similarity1
Binding sitei1865-phospho-alpha-D-ribose 1-diphosphateBy similarity1
Binding sitei203GTPBy similarity1
Binding sitei232GTPBy similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi176 – 179GTPBy similarity4

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

GTP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:HS12350-MONOMER.
BRENDAi2.4.2.9. 2681.

Names & Taxonomyi

Protein namesi
Recommended name:
Uracil phosphoribosyltransferase homolog
Gene namesi
Name:UPRT
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

HGNCiHGNC:28334. UPRT.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi139596.
OpenTargetsiENSG00000094841.
PharmGKBiPA162408652.

Polymorphism and mutation databases

BioMutaiUPRT.
DMDMi74751783.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002545351 – 309Uracil phosphoribosyltransferase homologAdd BLAST309

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei25PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ96BW1.
MaxQBiQ96BW1.
PaxDbiQ96BW1.
PeptideAtlasiQ96BW1.
PRIDEiQ96BW1.

PTM databases

iPTMnetiQ96BW1.
PhosphoSitePlusiQ96BW1.

Expressioni

Tissue specificityi

Highly expressed in leukocytes, liver, spleen and thymus, with lower expression in brain, lung and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000094841.
CleanExiHS_UPRT.
ExpressionAtlasiQ96BW1. baseline and differential.
GenevisibleiQ96BW1. HS.

Organism-specific databases

HPAiHPA000805.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
PYROXD1Q8WU106EBI-742943,EBI-742933

Protein-protein interaction databases

BioGridi126576. 8 interactors.
IntActiQ96BW1. 3 interactors.
MINTiMINT-1476786.
STRINGi9606.ENSP00000362481.

Structurei

3D structure databases

ProteinModelPortaliQ96BW1.
SMRiQ96BW1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni238 – 2465-phospho-alpha-D-ribose 1-diphosphate bindingBy similarity9
Regioni299 – 301Uracil bindingBy similarity3

Sequence similaritiesi

Belongs to the UPRTase family.Curated

Phylogenomic databases

eggNOGiKOG4203. Eukaryota.
COG0035. LUCA.
GeneTreeiENSGT00510000047272.
HOGENOMiHOG000262755.
HOVERGENiHBG105296.
InParanoidiQ96BW1.
KOiK00761.
OMAiVVNAFPK.
OrthoDBiEOG091G0U75.
PhylomeDBiQ96BW1.
TreeFamiTF105900.

Family and domain databases

CDDicd06223. PRTases_typeI. 1 hit.
Gene3Di3.40.50.2020. 1 hit.
InterProiIPR000836. PRibTrfase_dom.
IPR029057. PRTase-like.
[Graphical view]
PfamiPF14681. UPRTase. 1 hit.
[Graphical view]
SUPFAMiSSF53271. SSF53271. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96BW1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATELQCPDS MPCHNQQVNS ASTPSPEQLR PGDLILDHAG GNRASRAKVI
60 70 80 90 100
LLTGYAHSSL PAELDSGACG GSSLNSEGNS GSGDSSSYDA PAGNSFLEDC
110 120 130 140 150
ELSRQIGAQL KLLPMNDQIR ELQTIIRDKT ASRGDFMFSA DRLIRLVVEE
160 170 180 190 200
GLNQLPYKEC MVTTPTGYKY EGVKFEKGNC GVSIMRSGEA MEQGLRDCCR
210 220 230 240 250
SIRIGKILIQ SDEETQRAKV YYAKFPPDIY RRKVLLMYPI LSTGNTVIEA
260 270 280 290 300
VKVLIEHGVQ PSVIILLSLF STPHGAKSII QEFPEITILT TEVHPVAPTH

FGQKYFGTD
Length:309
Mass (Da):33,786
Last modified:December 1, 2001 - v1
Checksum:i5B3E77326345767B
GO
Isoform 2 (identifier: Q96BW1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-176: IRLVVEEGLNQLPYKECMVTTPTGYKYEGVKFE → VLPEDLFQKSIDNSCSAFHHQTCCGRGIESAAI
     177-309: Missing.

Note: No experimental confirmation available.
Show »
Length:176
Mass (Da):18,700
Checksum:i8C467592DB54C2D2
GO
Isoform 3 (identifier: Q96BW1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-114: Missing.
     276-281: AKSIIQ → EFSMRQ
     282-309: Missing.

Note: No experimental confirmation available.
Show »
Length:167
Mass (Da):19,056
Checksum:i1CF01617F74AC63A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti130T → A in CAH18190 (PubMed:17974005).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0212051 – 114Missing in isoform 3. 1 PublicationAdd BLAST114
Alternative sequenceiVSP_021206144 – 176IRLVV…GVKFE → VLPEDLFQKSIDNSCSAFHH QTCCGRGIESAAI in isoform 2. 1 PublicationAdd BLAST33
Alternative sequenceiVSP_021207177 – 309Missing in isoform 2. 1 PublicationAdd BLAST133
Alternative sequenceiVSP_021208276 – 281AKSIIQ → EFSMRQ in isoform 3. 1 Publication6
Alternative sequenceiVSP_021209282 – 309Missing in isoform 3. 1 PublicationAdd BLAST28

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056354 mRNA. No translation available.
CR749336 mRNA. Translation: CAH18190.1.
AL590234, AL137013 Genomic DNA. Translation: CAI39681.1.
AL590234, AL137013 Genomic DNA. Translation: CAI39682.1.
AL137013, AL590234 Genomic DNA. Translation: CAI40088.1.
AL137013, AL590234 Genomic DNA. Translation: CAI40089.1.
BC015116 mRNA. Translation: AAH15116.1.
CCDSiCCDS14429.1. [Q96BW1-1]
RefSeqiNP_659489.1. NM_145052.3. [Q96BW1-1]
UniGeneiHs.91612.

Genome annotation databases

EnsembliENST00000373383; ENSP00000362481; ENSG00000094841. [Q96BW1-1]
ENST00000462237; ENSP00000433987; ENSG00000094841. [Q96BW1-2]
GeneIDi139596.
KEGGihsa:139596.
UCSCiuc004ecb.3. human. [Q96BW1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056354 mRNA. No translation available.
CR749336 mRNA. Translation: CAH18190.1.
AL590234, AL137013 Genomic DNA. Translation: CAI39681.1.
AL590234, AL137013 Genomic DNA. Translation: CAI39682.1.
AL137013, AL590234 Genomic DNA. Translation: CAI40088.1.
AL137013, AL590234 Genomic DNA. Translation: CAI40089.1.
BC015116 mRNA. Translation: AAH15116.1.
CCDSiCCDS14429.1. [Q96BW1-1]
RefSeqiNP_659489.1. NM_145052.3. [Q96BW1-1]
UniGeneiHs.91612.

3D structure databases

ProteinModelPortaliQ96BW1.
SMRiQ96BW1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126576. 8 interactors.
IntActiQ96BW1. 3 interactors.
MINTiMINT-1476786.
STRINGi9606.ENSP00000362481.

PTM databases

iPTMnetiQ96BW1.
PhosphoSitePlusiQ96BW1.

Polymorphism and mutation databases

BioMutaiUPRT.
DMDMi74751783.

Proteomic databases

EPDiQ96BW1.
MaxQBiQ96BW1.
PaxDbiQ96BW1.
PeptideAtlasiQ96BW1.
PRIDEiQ96BW1.

Protocols and materials databases

DNASUi139596.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000373383; ENSP00000362481; ENSG00000094841. [Q96BW1-1]
ENST00000462237; ENSP00000433987; ENSG00000094841. [Q96BW1-2]
GeneIDi139596.
KEGGihsa:139596.
UCSCiuc004ecb.3. human. [Q96BW1-1]

Organism-specific databases

CTDi139596.
DisGeNETi139596.
GeneCardsiUPRT.
H-InvDBHIX0016881.
HGNCiHGNC:28334. UPRT.
HPAiHPA000805.
MIMi300656. gene.
neXtProtiNX_Q96BW1.
OpenTargetsiENSG00000094841.
PharmGKBiPA162408652.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4203. Eukaryota.
COG0035. LUCA.
GeneTreeiENSGT00510000047272.
HOGENOMiHOG000262755.
HOVERGENiHBG105296.
InParanoidiQ96BW1.
KOiK00761.
OMAiVVNAFPK.
OrthoDBiEOG091G0U75.
PhylomeDBiQ96BW1.
TreeFamiTF105900.

Enzyme and pathway databases

BioCyciZFISH:HS12350-MONOMER.
BRENDAi2.4.2.9. 2681.

Miscellaneous databases

GenomeRNAii139596.
PROiQ96BW1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000094841.
CleanExiHS_UPRT.
ExpressionAtlasiQ96BW1. baseline and differential.
GenevisibleiQ96BW1. HS.

Family and domain databases

CDDicd06223. PRTases_typeI. 1 hit.
Gene3Di3.40.50.2020. 1 hit.
InterProiIPR000836. PRibTrfase_dom.
IPR029057. PRTase-like.
[Graphical view]
PfamiPF14681. UPRTase. 1 hit.
[Graphical view]
SUPFAMiSSF53271. SSF53271. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiUPP_HUMAN
AccessioniPrimary (citable) accession number: Q96BW1
Secondary accession number(s): Q5JRL1
, Q5JRL3, Q68DN0, Q96MW2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: December 1, 2001
Last modified: November 30, 2016
This is version 116 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

No UPRTase activity has been detected in vitro and the uracil binding region known from UPRTases is missing.1 Publication

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.