Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM149B1

Gene

FAM149B1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM149B1
Gene namesi
Name:FAM149B1
Synonyms:KIAA0974
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 10

Organism-specific databases

HGNCiHGNC:29162. FAM149B1.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162386399.

Polymorphism and mutation databases

BioMutaiFAM149B1.
DMDMi182676632.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 582582Protein FAM149B1PRO_0000319933Add
BLAST

Proteomic databases

PaxDbiQ96BN6.
PeptideAtlasiQ96BN6.
PRIDEiQ96BN6.

PTM databases

iPTMnetiQ96BN6.
PhosphoSiteiQ96BN6.

Expressioni

Gene expression databases

BgeeiQ96BN6.
CleanExiHS_FAM149B1.
ExpressionAtlasiQ96BN6. baseline and differential.
GenevisibleiQ96BN6. HS.

Organism-specific databases

HPAiHPA039189.
HPA039859.

Interactioni

Protein-protein interaction databases

BioGridi130429. 2 interactions.
STRINGi9606.ENSP00000242505.

Structurei

3D structure databases

ProteinModelPortaliQ96BN6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM149 family.Curated

Phylogenomic databases

eggNOGiENOG410IE96. Eukaryota.
ENOG410ZYXN. LUCA.
GeneTreeiENSGT00530000063727.
HOGENOMiHOG000065676.
HOVERGENiHBG107888.
InParanoidiQ96BN6.
OMAiVEYPHQA.
OrthoDBiEOG7R8319.
PhylomeDBiQ96BN6.
TreeFamiTF330725.

Family and domain databases

InterProiIPR022194. DUF3719.
[Graphical view]
PfamiPF12516. DUF3719. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q96BN6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MISRYTRKAV PQSLELKGIT KHALNHHPPP EKLEEISPTS DSHEKDTSSQ
60 70 80 90 100
SKSDITRESS FTSADTGNSL SAFPSYTGAG ISTEGSSDFS WGYGELDQNA
110 120 130 140 150
TEKVQTMFTA IDELLYEQKL SVHTKSLQEE CQQWTASFPH LRILGRQIIT
160 170 180 190 200
PSEGYRLYPR SPSAVSASYE TTLSQERDST IFGIRGKKLH FSSSYAHKAS
210 220 230 240 250
SIAKSSSFCS MERDEEDSII VSEGIIEEYL AFDHIDIEEG FHGKKSEAAT
260 270 280 290 300
EKQKLGYPPI APFYCMKEDV LAYVFDSVWC KVVSCMEQLT RSHWEGFASD
310 320 330 340 350
DESNVAVTRP DSESSCVLSE LHPLVLPRVP QSKVLYITSN PMSLCQASRH
360 370 380 390 400
QPNVNDLLVH GMPLQPRNLS LMDKLLDLDD KLLMRPGSST ILSTRNWPNR
410 420 430 440 450
AVEFSTSSLS YTVQSTRRRN PPPRTLHPIS TSHSCAETPR SVEEILRGAR
460 470 480 490 500
VPVAPDSLSS PSPTPLSRNN LLPPIGTAEV EHVSTVGPQR QMKPHGDSSR
510 520 530 540 550
AQSAVVDEPN YQQPQERLLL PDFFPRPNTT QSFLLDTQYR RSCAVEYPHQ
560 570 580
ARPGRGSAGP QLHGSTKSQS GGRPVSRTRQ GP
Length:582
Mass (Da):64,618
Last modified:February 26, 2008 - v2
Checksum:i5DA856203C1A26B7
GO
Isoform 2 (identifier: Q96BN6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     334-341: Missing.
     535-582: LDTQYRRSCAVEYPHQARPGRGSAGPQLHGSTKSQSGGRPVSRTRQGP → VE

Note: No experimental confirmation available.
Show »
Length:528
Mass (Da):58,800
Checksum:i307FE2DF16034F61
GO

Sequence cautioni

The sequence AAH15394.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti571 – 5711G → R.
Corresponds to variant rs12573841 [ dbSNP | Ensembl ].
VAR_060167

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei334 – 3418Missing in isoform 2. 1 PublicationVSP_031533
Alternative sequencei535 – 58248LDTQY…TRQGP → VE in isoform 2. 1 PublicationVSP_031534Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC016394 Genomic DNA. No translation available.
AB023191 mRNA. Translation: BAA76818.1.
BC015394 mRNA. Translation: AAH15394.1. Different initiation.
CCDSiCCDS44435.1. [Q96BN6-1]
RefSeqiNP_775483.1. NM_173348.1. [Q96BN6-1]
XP_005269803.1. XM_005269746.2. [Q96BN6-2]
UniGeneiHs.408577.

Genome annotation databases

EnsembliENST00000242505; ENSP00000242505; ENSG00000138286. [Q96BN6-1]
GeneIDi317662.
KEGGihsa:317662.
UCSCiuc009xqz.4. human. [Q96BN6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC016394 Genomic DNA. No translation available.
AB023191 mRNA. Translation: BAA76818.1.
BC015394 mRNA. Translation: AAH15394.1. Different initiation.
CCDSiCCDS44435.1. [Q96BN6-1]
RefSeqiNP_775483.1. NM_173348.1. [Q96BN6-1]
XP_005269803.1. XM_005269746.2. [Q96BN6-2]
UniGeneiHs.408577.

3D structure databases

ProteinModelPortaliQ96BN6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi130429. 2 interactions.
STRINGi9606.ENSP00000242505.

PTM databases

iPTMnetiQ96BN6.
PhosphoSiteiQ96BN6.

Polymorphism and mutation databases

BioMutaiFAM149B1.
DMDMi182676632.

Proteomic databases

PaxDbiQ96BN6.
PeptideAtlasiQ96BN6.
PRIDEiQ96BN6.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000242505; ENSP00000242505; ENSG00000138286. [Q96BN6-1]
GeneIDi317662.
KEGGihsa:317662.
UCSCiuc009xqz.4. human. [Q96BN6-1]

Organism-specific databases

CTDi317662.
GeneCardsiFAM149B1.
H-InvDBHIX0008919.
HIX0035485.
HGNCiHGNC:29162. FAM149B1.
HPAiHPA039189.
HPA039859.
neXtProtiNX_Q96BN6.
PharmGKBiPA162386399.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IE96. Eukaryota.
ENOG410ZYXN. LUCA.
GeneTreeiENSGT00530000063727.
HOGENOMiHOG000065676.
HOVERGENiHBG107888.
InParanoidiQ96BN6.
OMAiVEYPHQA.
OrthoDBiEOG7R8319.
PhylomeDBiQ96BN6.
TreeFamiTF330725.

Miscellaneous databases

ChiTaRSiFAM149B1. human.
GenomeRNAii317662.
PROiQ96BN6.

Gene expression databases

BgeeiQ96BN6.
CleanExiHS_FAM149B1.
ExpressionAtlasiQ96BN6. baseline and differential.
GenevisibleiQ96BN6. HS.

Family and domain databases

InterProiIPR022194. DUF3719.
[Graphical view]
PfamiPF12516. DUF3719. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "The DNA sequence and comparative analysis of human chromosome 10."
    Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
    , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
    Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  2. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 18-582 (ISOFORM 1).
    Tissue: Brain.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 61-582 (ISOFORM 2).
    Tissue: Prostate.

Entry informationi

Entry nameiF149B_HUMAN
AccessioniPrimary (citable) accession number: Q96BN6
Secondary accession number(s): Q9Y2I0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: July 6, 2016
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.