Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Engulfment and cell motility protein 3

Gene

ELMO3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1 (By similarity).By similarity

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Phagocytosis

Names & Taxonomyi

Protein namesi
Recommended name:
Engulfment and cell motility protein 3
Gene namesi
Name:ELMO3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:17289. ELMO3.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA27756.

Polymorphism and mutation databases

BioMutaiELMO3.
DMDMi238054390.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 720720Engulfment and cell motility protein 3PRO_0000153716Add
BLAST

Proteomic databases

EPDiQ96BJ8.
MaxQBiQ96BJ8.
PaxDbiQ96BJ8.
PeptideAtlasiQ96BJ8.
PRIDEiQ96BJ8.

PTM databases

iPTMnetiQ96BJ8.
PhosphoSiteiQ96BJ8.

Expressioni

Gene expression databases

BgeeiQ96BJ8.
CleanExiHS_ELMO3.
ExpressionAtlasiQ96BJ8. baseline and differential.
GenevisibleiQ96BJ8. HS.

Organism-specific databases

HPAiHPA021484.

Interactioni

Subunit structurei

Probably interacts directly with the SH3-domain of DOCK1 via its SH3-binding site. Part of a complex with DOCK1 and RAC1 (By similarity). Interacts with ADGRB3 (PubMed:24567399).By similarity1 Publication

Protein-protein interaction databases

BioGridi122872. 20 interactions.
IntActiQ96BJ8. 14 interactions.
STRINGi9606.ENSP00000377566.

Structurei

3D structure databases

ProteinModelPortaliQ96BJ8.
SMRiQ96BJ8. Positions 516-716.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini307 – 479173ELMOPROSITE-ProRule annotationAdd
BLAST
Domaini542 – 664123PHAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi696 – 70611SH3-bindingAdd
BLAST

Sequence similaritiesi

Contains 1 ELMO domain.PROSITE-ProRule annotation
Contains 1 PH domain.Curated

Keywords - Domaini

SH3-binding

Phylogenomic databases

eggNOGiKOG2999. Eukaryota.
ENOG410XPKN. LUCA.
GeneTreeiENSGT00390000014155.
HOGENOMiHOG000230985.
HOVERGENiHBG051463.
InParanoidiQ96BJ8.
KOiK19241.
OMAiMGSEQTR.
PhylomeDBiQ96BJ8.
TreeFamiTF312966.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR024574. DUF3361.
IPR030719. ELMO3.
IPR006816. ELMO_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12771:SF16. PTHR12771:SF16. 1 hit.
PfamiPF11841. DUF3361. 1 hit.
PF04727. ELMO_CED12. 1 hit.
PF16457. PH_12. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS51335. ELMO. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 2 (identifier: Q96BJ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAPPRNVVKI AIKMRDAIPQ LIQLDQAKPL AAVLKEVCDA WSLTHSERYA
60 70 80 90 100
LQFADGHRRY ITENNRAEIK NGSILCLSTA PDLEAEQLLG GLQSNSPEGR
110 120 130 140 150
REALRRLVPL ASDMIFAREV ISRNGLQILG TIIEDGDDLG EVLALSLRAF
160 170 180 190 200
SELMEHGVVS WETLSIPFVR KVVCYVNMNL MDASVPPLAL GLLESVTLSS
210 220 230 240 250
PALGQLVKSE VPLDRLLVHL QVMNQQLQTK AMALLTALLQ GASPVERKHM
260 270 280 290 300
LDYLWQRNLR QFIYKNIIHS AAPMGDEMAH HLYVLQALML GLLEPRMRTP
310 320 330 340 350
LDPYSQEQRE QLQVLRQAAF EVEGESSGAG LSADRRRSLC AREFRKLGFS
360 370 380 390 400
NSNPAQDLER VPPGLLALDN MLYFSRNAPS AYSRFVLENS SREDKHECPF
410 420 430 440 450
ARGSIQLTVL LCELLRVGEP CSETAQDFSP MFFGQDQSFH ELFCVGIQLL
460 470 480 490 500
NKTWKEMRAT QEDFDKVMQV VREQLARTLA LKPTSLELFR TKVNALTYGE
510 520 530 540 550
VLRLRQTERL HQEGTLAPPI LELREKLKPE LMGLIRQQRL LRLCEGTLFR
560 570 580 590 600
KISSRRRQDK LWFCCLSPNH KLLQYGDMEE GASPPTLESL PEQLPVADMR
610 620 630 640 650
ALLTGKDCPH VREKGSGKQN KDLYELAFSI SYDRGEEEAY LNFIAPSKRE
660 670 680 690 700
FYLWTDGLSA LLGSPMGSEQ TRLDLEQLLT METKLRLLEL ENVPIPERPP
710 720
PVPPPPTNFN FCYDCSIAEP
Length:720
Mass (Da):81,467
Last modified:May 26, 2009 - v3
Checksum:iD8D81291B059618D
GO
Isoform 1 (identifier: Q96BJ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.

Show »
Length:607
Mass (Da):68,941
Checksum:iEFE9C8DBD7CB453B
GO
Isoform 3 (identifier: Q96BJ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MARSSSLGRECGTPRSGLGKGGPPRPQGPQARCTLGRRCTVSGKCRRPRPSWTM

Show »
Length:773
Mass (Da):87,102
Checksum:i901829EC2C3BD0B7
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti65 – 651N → S in BAG62598 (PubMed:14702039).Curated
Sequence conflicti555 – 5551R → Q in BAG62598 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti13 – 131K → Q.1 Publication
Corresponds to variant rs12923138 [ dbSNP | Ensembl ].
VAR_055402
Natural varianti95 – 951N → D.
Corresponds to variant rs8058861 [ dbSNP | Ensembl ].
VAR_055403
Natural varianti316 – 3161R → C.
Corresponds to variant rs33948247 [ dbSNP | Ensembl ].
VAR_055404

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 113113Missing in isoform 1. 2 PublicationsVSP_037341Add
BLAST
Alternative sequencei1 – 11M → MARSSSLGRECGTPRSGLGK GGPPRPQGPQARCTLGRRCT VSGKCRRPRPSWTM in isoform 3. 1 PublicationVSP_037342

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK300976 mRNA. Translation: BAG62598.1.
AK023886 mRNA. Translation: BAB14712.1.
AC040160 Genomic DNA. No translation available.
BC015524 mRNA. Translation: AAH15524.1.
BC034410 mRNA. Translation: AAH34410.2.
CCDSiCCDS10833.2. [Q96BJ8-3]
RefSeqiNP_078988.2. NM_024712.3. [Q96BJ8-3]
UniGeneiHs.377416.

Genome annotation databases

EnsembliENST00000393997; ENSP00000377566; ENSG00000102890. [Q96BJ8-3]
ENST00000477898; ENSP00000458539; ENSG00000102890. [Q96BJ8-2]
GeneIDi79767.
KEGGihsa:79767.
UCSCiuc002esa.4. human. [Q96BJ8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK300976 mRNA. Translation: BAG62598.1.
AK023886 mRNA. Translation: BAB14712.1.
AC040160 Genomic DNA. No translation available.
BC015524 mRNA. Translation: AAH15524.1.
BC034410 mRNA. Translation: AAH34410.2.
CCDSiCCDS10833.2. [Q96BJ8-3]
RefSeqiNP_078988.2. NM_024712.3. [Q96BJ8-3]
UniGeneiHs.377416.

3D structure databases

ProteinModelPortaliQ96BJ8.
SMRiQ96BJ8. Positions 516-716.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122872. 20 interactions.
IntActiQ96BJ8. 14 interactions.
STRINGi9606.ENSP00000377566.

PTM databases

iPTMnetiQ96BJ8.
PhosphoSiteiQ96BJ8.

Polymorphism and mutation databases

BioMutaiELMO3.
DMDMi238054390.

Proteomic databases

EPDiQ96BJ8.
MaxQBiQ96BJ8.
PaxDbiQ96BJ8.
PeptideAtlasiQ96BJ8.
PRIDEiQ96BJ8.

Protocols and materials databases

DNASUi79767.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393997; ENSP00000377566; ENSG00000102890. [Q96BJ8-3]
ENST00000477898; ENSP00000458539; ENSG00000102890. [Q96BJ8-2]
GeneIDi79767.
KEGGihsa:79767.
UCSCiuc002esa.4. human. [Q96BJ8-1]

Organism-specific databases

CTDi79767.
GeneCardsiELMO3.
H-InvDBHIX0013139.
HGNCiHGNC:17289. ELMO3.
HPAiHPA021484.
MIMi606422. gene.
neXtProtiNX_Q96BJ8.
PharmGKBiPA27756.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2999. Eukaryota.
ENOG410XPKN. LUCA.
GeneTreeiENSGT00390000014155.
HOGENOMiHOG000230985.
HOVERGENiHBG051463.
InParanoidiQ96BJ8.
KOiK19241.
OMAiMGSEQTR.
PhylomeDBiQ96BJ8.
TreeFamiTF312966.

Miscellaneous databases

GenomeRNAii79767.
PROiQ96BJ8.
SOURCEiSearch...

Gene expression databases

BgeeiQ96BJ8.
CleanExiHS_ELMO3.
ExpressionAtlasiQ96BJ8. baseline and differential.
GenevisibleiQ96BJ8. HS.

Family and domain databases

Gene3Di2.30.29.30. 1 hit.
InterProiIPR016024. ARM-type_fold.
IPR024574. DUF3361.
IPR030719. ELMO3.
IPR006816. ELMO_dom.
IPR011993. PH_dom-like.
IPR001849. PH_domain.
[Graphical view]
PANTHERiPTHR12771:SF16. PTHR12771:SF16. 1 hit.
PfamiPF11841. DUF3361. 1 hit.
PF04727. ELMO_CED12. 1 hit.
PF16457. PH_12. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
SSF50729. SSF50729. 1 hit.
PROSITEiPS51335. ELMO. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT GLN-13.
    Tissue: Small intestine and Thyroid.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 63-720 (ISOFORM 1).
    Tissue: Brain and Colon.
  4. "G-protein coupled receptor BAI3 promotes myoblast fusion in vertebrates."
    Hamoud N., Tran V., Croteau L.P., Kania A., Cote J.F.
    Proc. Natl. Acad. Sci. U.S.A. 111:3745-3750(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ADGRB3.

Entry informationi

Entry nameiELMO3_HUMAN
AccessioniPrimary (citable) accession number: Q96BJ8
Secondary accession number(s): B4DV86, Q9H8A5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2003
Last sequence update: May 26, 2009
Last modified: July 6, 2016
This is version 120 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.