SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96BD5

- PF21A_HUMAN

UniProt

Q96BD5 - PF21A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

PHD finger protein 21A

Gene
PHF21A, BHC80, KIAA1696, BM-006
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation.1 Publication

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi425 – 43713A.T hookAdd
BLAST
Zinc fingeri488 – 53548PHD-typeAdd
BLAST

GO - Molecular functioni

  1. chromatin binding Source: Ensembl
  2. DNA binding Source: UniProtKB-KW
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. blood coagulation Source: Reactome
  2. chromatin modification Source: UniProtKB-KW
  3. negative regulation of transcription from RNA polymerase II promoter Source: MGI
  4. regulation of transcription, DNA-templated Source: UniProtKB-KW
  5. suckling behavior Source: Ensembl
  6. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 21A
Alternative name(s):
BHC80a
BRAF35-HDAC complex protein BHC80
Gene namesi
Name:PHF21A
Synonyms:BHC80, KIAA1696
ORF Names:BM-006
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 11

Organism-specific databases

HGNCiHGNC:24156. PHF21A.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. histone deacetylase complex Source: MGI
  2. nucleoplasm Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

Orphaneti52022. Potocki-Shaffer syndrome.
PharmGKBiPA134977844.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 680680PHD finger protein 21APRO_0000226767Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei444 – 4441Phosphothreonine1 Publication
Modified residuei447 – 4471Phosphoserine1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ96BD5.
PaxDbiQ96BD5.
PRIDEiQ96BD5.

PTM databases

PhosphoSiteiQ96BD5.

Expressioni

Tissue specificityi

Highly expressed in brain. Expressed at much lower level in other tissues.1 Publication

Gene expression databases

ArrayExpressiQ96BD5.
BgeeiQ96BD5.
CleanExiHS_PHF21A.
GenevestigatoriQ96BD5.

Organism-specific databases

HPAiHPA023580.

Interactioni

Subunit structurei

Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST.3 Publications

Protein-protein interaction databases

BioGridi119468. 13 interactions.
DIPiDIP-60252N.
IntActiQ96BD5. 9 interactions.
MINTiMINT-1469147.
STRINGi9606.ENSP00000398824.

Structurei

Secondary structure

1
680
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Turni492 – 4943
Beta strandi504 – 5074
Helixi512 – 5143
Beta strandi515 – 5173
Helixi530 – 5389
Turni539 – 5424

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2PUYX-ray1.43A/B486-543[»]
2YQLNMR-A487-535[»]
ProteinModelPortaliQ96BD5.
SMRiQ96BD5. Positions 486-543.

Miscellaneous databases

EvolutionaryTraceiQ96BD5.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni486 – 680195Required for transcriptional repressionAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili558 – 60346 Reviewed predictionAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi4 – 108105Gln-richAdd
BLAST

Sequence similaritiesi

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri488 – 53548PHD-typeAdd
BLAST

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

eggNOGiNOG310379.
HOVERGENiHBG080293.
InParanoidiQ96BD5.
OMAiHHHAQSA.
OrthoDBiEOG7WMCHZ.
PhylomeDBiQ96BD5.
TreeFamiTF331518.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR017956. AT_hook_DNA-bd_motif.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF02178. AT_hook. 1 hit.
PF00628. PHD. 1 hit.
[Graphical view]
SMARTiSM00384. AT_hook. 1 hit.
SM00249. PHD. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 1 hit.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96BD5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK    50
QKRVVEQLRK NLIVKQEQPD KFQIQPLPQS ENKLQTAQQQ PLQQLQQQQQ 100
YHHHHAQQSA AASPNLTASQ KTVTTASMIT TKTLPLVLKA ATATMPASVV 150
GQRPTIAMVT AINSQKAVLS TDVQNTPVNL QTSSKVTGPG AEAVQIVAKN 200
TVTLVQATPP QPIKVPQFIP PPRLTPRPNF LPQVRPKPVA QNNIPIAPAP 250
PPMLAAPQLI QRPVMLTKFT PTTLPTSQNS IHPVRVVNGQ TATIAKTFPM 300
AQLTSIVIAT PGTRLAGPQT VQLSKPSLEK QTVKSHTETD EKQTESRTIT 350
PPAAPKPKRE ENPQKLAFMV SLGLVTHDHL EEIQSKRQER KRRTTANPVY 400
SGAVFEPERK KSAVTYLNST MHPGTRKRGR PPKYNAVLGF GALTPTSPQS 450
SHPDSPENEK TETTFTFPAP VQPVSLPSPT STDGDIHEDF CSVCRKSGQL 500
LMCDTCSRVY HLDCLDPPLK TIPKGMWICP RCQDQMLKKE EAIPWPGTLA 550
IVHSYIAYKA AKEEEKQKLL KWSSDLKQER EQLEQKVKQL SNSISKCMEM 600
KNTILARQKE MHSSLEKVKQ LIRLIHGIDL SKPVDSEATV GAISNGPDCT 650
PPANAATSTP APSPSSQSCT ANCNQGEETK 680
Length:680
Mass (Da):74,854
Last modified:December 1, 2001 - v1
Checksum:iC7AF87EB2984A796
GO
Isoform 2 (identifier: Q96BD5-2) [UniParc]FASTAAdd to Basket

Also known as: hBHC80-4

The sequence of this isoform differs from the canonical sequence as follows:
     204-204: L → LQ
     429-483: GRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:634
Mass (Da):70,210
Checksum:iB1F247CD92D7D411
GO
Isoform 3 (identifier: Q96BD5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     204-204: L → LQ

Show »
Length:681
Mass (Da):74,982
Checksum:iF95DC57A1D3C0FEC
GO

Sequence cautioni

The sequence AAF64262.1 differs from that shown. Reason: Frameshift at several positions.
The sequence BAB21787.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti347 – 3471R → H.2 Publications
Corresponds to variant rs3736508 [ dbSNP | Ensembl ].
VAR_025515

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei204 – 2041L → LQ in isoform 2 and isoform 3. VSP_017448
Alternative sequencei429 – 48355GRPPK…PTSTD → ANEEHWPK in isoform 2. VSP_017449Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti447 – 4471S → P in BAB13839. 1 Publication
Sequence conflicti662 – 68019PSPSS…GEETK → LCSLPELHSEL1 PublicationAdd
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY090777 mRNA. Translation: AAM09095.1.
AB051483 mRNA. Translation: BAB21787.1. Different initiation.
AK021530 mRNA. Translation: BAB13839.1.
AK023258 mRNA. Translation: BAB14492.1.
CH471064 Genomic DNA. Translation: EAW68012.1.
CH471064 Genomic DNA. Translation: EAW68013.1.
CH471064 Genomic DNA. Translation: EAW68015.1.
CH471064 Genomic DNA. Translation: EAW68017.1.
BC015714 mRNA. Translation: AAH15714.1.
BX648236 mRNA. Translation: CAH10542.1.
AF208848 mRNA. Translation: AAF64262.1. Frameshift.
CCDSiCCDS31474.1. [Q96BD5-2]
CCDS44578.1. [Q96BD5-1]
RefSeqiNP_001095272.1. NM_001101802.1. [Q96BD5-1]
NP_057705.3. NM_016621.3. [Q96BD5-2]
XP_005253019.1. XM_005252962.2. [Q96BD5-3]
XP_005253020.1. XM_005252963.2. [Q96BD5-3]
XP_005253021.1. XM_005252964.2. [Q96BD5-3]
XP_005253022.1. XM_005252965.2. [Q96BD5-3]
UniGeneiHs.502458.

Genome annotation databases

EnsembliENST00000257821; ENSP00000257821; ENSG00000135365. [Q96BD5-3]
ENST00000323180; ENSP00000323152; ENSG00000135365. [Q96BD5-2]
ENST00000418153; ENSP00000398824; ENSG00000135365. [Q96BD5-1]
GeneIDi51317.
KEGGihsa:51317.
UCSCiuc001ncb.4. human. [Q96BD5-2]
uc001ncc.4. human. [Q96BD5-1]
uc001nce.2. human. [Q96BD5-3]

Polymorphism databases

DMDMi74731224.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY090777 mRNA. Translation: AAM09095.1 .
AB051483 mRNA. Translation: BAB21787.1 . Different initiation.
AK021530 mRNA. Translation: BAB13839.1 .
AK023258 mRNA. Translation: BAB14492.1 .
CH471064 Genomic DNA. Translation: EAW68012.1 .
CH471064 Genomic DNA. Translation: EAW68013.1 .
CH471064 Genomic DNA. Translation: EAW68015.1 .
CH471064 Genomic DNA. Translation: EAW68017.1 .
BC015714 mRNA. Translation: AAH15714.1 .
BX648236 mRNA. Translation: CAH10542.1 .
AF208848 mRNA. Translation: AAF64262.1 . Frameshift.
CCDSi CCDS31474.1. [Q96BD5-2 ]
CCDS44578.1. [Q96BD5-1 ]
RefSeqi NP_001095272.1. NM_001101802.1. [Q96BD5-1 ]
NP_057705.3. NM_016621.3. [Q96BD5-2 ]
XP_005253019.1. XM_005252962.2. [Q96BD5-3 ]
XP_005253020.1. XM_005252963.2. [Q96BD5-3 ]
XP_005253021.1. XM_005252964.2. [Q96BD5-3 ]
XP_005253022.1. XM_005252965.2. [Q96BD5-3 ]
UniGenei Hs.502458.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2PUY X-ray 1.43 A/B 486-543 [» ]
2YQL NMR - A 487-535 [» ]
ProteinModelPortali Q96BD5.
SMRi Q96BD5. Positions 486-543.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119468. 13 interactions.
DIPi DIP-60252N.
IntActi Q96BD5. 9 interactions.
MINTi MINT-1469147.
STRINGi 9606.ENSP00000398824.

PTM databases

PhosphoSitei Q96BD5.

Polymorphism databases

DMDMi 74731224.

Proteomic databases

MaxQBi Q96BD5.
PaxDbi Q96BD5.
PRIDEi Q96BD5.

Protocols and materials databases

DNASUi 51317.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000257821 ; ENSP00000257821 ; ENSG00000135365 . [Q96BD5-3 ]
ENST00000323180 ; ENSP00000323152 ; ENSG00000135365 . [Q96BD5-2 ]
ENST00000418153 ; ENSP00000398824 ; ENSG00000135365 . [Q96BD5-1 ]
GeneIDi 51317.
KEGGi hsa:51317.
UCSCi uc001ncb.4. human. [Q96BD5-2 ]
uc001ncc.4. human. [Q96BD5-1 ]
uc001nce.2. human. [Q96BD5-3 ]

Organism-specific databases

CTDi 51317.
GeneCardsi GC11M045950.
HGNCi HGNC:24156. PHF21A.
HPAi HPA023580.
MIMi 608325. gene.
neXtProti NX_Q96BD5.
Orphaneti 52022. Potocki-Shaffer syndrome.
PharmGKBi PA134977844.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG310379.
HOVERGENi HBG080293.
InParanoidi Q96BD5.
OMAi HHHAQSA.
OrthoDBi EOG7WMCHZ.
PhylomeDBi Q96BD5.
TreeFami TF331518.

Enzyme and pathway databases

Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

Miscellaneous databases

EvolutionaryTracei Q96BD5.
GeneWikii PHF21A.
GenomeRNAii 51317.
NextBioi 54681.
PROi Q96BD5.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96BD5.
Bgeei Q96BD5.
CleanExi HS_PHF21A.
Genevestigatori Q96BD5.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR017956. AT_hook_DNA-bd_motif.
IPR019786. Zinc_finger_PHD-type_CS.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF02178. AT_hook. 1 hit.
PF00628. PHD. 1 hit.
[Graphical view ]
SMARTi SM00384. AT_hook. 1 hit.
SM00249. PHD. 1 hit.
SM00184. RING. 1 hit.
[Graphical view ]
SUPFAMi SSF57903. SSF57903. 1 hit.
PROSITEi PS01359. ZF_PHD_1. 1 hit.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes."
    Hakimi M.-A., Bochar D.A., Chenoweth J., Lane W.S., Mandel G., Shiekhattar R.
    Proc. Natl. Acad. Sci. U.S.A. 99:7420-7425(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1, TISSUE SPECIFICITY, VARIANT HIS-347.
  2. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
    DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-456 (ISOFORM 3), VARIANT HIS-347.
    Tissue: Embryo and Teratocarcinoma.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Uterus.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 121-680 (ISOFORM 1).
    Tissue: Fetal kidney.
  7. "A novel gene expressed in human bone marrow."
    Zhao M., Song H., Li N., Peng Y., Han Z., Chen Z.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 284-672 (ISOFORMS 2/3).
    Tissue: Bone marrow.
  8. "A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes."
    Hakimi M.-A., Dong Y., Lane W.S., Speicher D.W., Shiekhattar R.
    J. Biol. Chem. 278:7234-7239(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A; RCOR1; ZMYM2; ZNF217; ZMYM3; KIAA0182 AND GTF2I.
  9. "Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression."
    Iwase S., Januma A., Miyamoto K., Shono N., Honda A., Yanagisawa J., Baba T.
    Biochem. Biophys. Res. Commun. 322:601-608(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1.
  10. "Regulation of LSD1 histone demethylase activity by its associated factors."
    Shi Y.-J., Matson C., Lan F., Iwase S., Baba T., Shi Y.
    Mol. Cell 19:857-864(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-444 AND SER-447, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Solution structure of the PHD domain in PHD finger protein 21A."
    RIKEN structural genomics initiative (RSGI)
    Submitted (MAR-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 487-535.

Entry informationi

Entry nameiPF21A_HUMAN
AccessioniPrimary (citable) accession number: Q96BD5
Secondary accession number(s): D3DQP5
, Q6AWA2, Q9C0G7, Q9H8V9, Q9HAK6, Q9NZE9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: December 1, 2001
Last modified: September 3, 2014
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi