Q96BD5 (PF21A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 104.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: PHD finger protein 21A Alternative name(s): BHC80a BRAF35-HDAC complex protein BHC80 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 680 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation. Ref.10 |
| Subunit structure | Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST. Ref.1 Ref.8 Ref.9 |
| Subcellular location | Nucleus By similarity. |
| Tissue specificity | Highly expressed in brain. Expressed at much lower level in other tissues. Ref.1 |
| Sequence similarities | Contains 1 A.T hook DNA-binding domain. Contains 1 PHD-type zinc finger. |
| Sequence caution | The sequence AAF64262.1 differs from that shown. Reason: Frameshift at several positions. The sequence BAB21787.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96BD5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96BD5-2) Also known as: hBHC80-4; The sequence of this isoform differs from the canonical sequence as follows: 204-204: L → LQ 429-483: GRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK | ||||||
| Isoform 3 (identifier: Q96BD5-3) The sequence of this isoform differs from the canonical sequence as follows: 204-204: L → LQ |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||
Molecule processing | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 680 | 680 | PHD finger protein 21A | PRO_0000226767 | |||||||||||||||
Regions | |||||||||||||||||||
| DNA binding | 425 – 437 | 13 | A.T hook | ||||||||||||||||
| Zinc finger | 488 – 535 | 48 | PHD-type | ||||||||||||||||
| Region | 486 – 680 | 195 | Required for transcriptional repression | ||||||||||||||||
| Coiled coil | 558 – 603 | 46 | Potential | ||||||||||||||||
| Compositional bias | 4 – 108 | 105 | Gln-rich | ||||||||||||||||
Amino acid modifications | |||||||||||||||||||
| Modified residue | 444 | 1 | Phosphothreonine Ref.12 | ||||||||||||||||
| Modified residue | 447 | 1 | Phosphoserine Ref.12 | ||||||||||||||||
Natural variations | |||||||||||||||||||
| Alternative sequence | 204 | 1 | L → LQ in isoform 2 and isoform 3. | VSP_017448 | |||||||||||||||
| Alternative sequence | 429 – 483 | 55 | GRPPK…PTSTD → ANEEHWPK in isoform 2. | VSP_017449 | |||||||||||||||
| Natural variant | 347 | 1 | R → H. Ref.1 Ref.3 Corresponds to variant rs3736508 [ dbSNP | Ensembl ]. | VAR_025515 | |||||||||||||||
Experimental info | |||||||||||||||||||
| Sequence conflict | 447 | 1 | S → P in BAB13839. Ref.3 | ||||||||||||||||
| Sequence conflict | 662 – 680 | 19 | PSPSS…GEETK → LCSLPELHSEL Ref.7 | ||||||||||||||||
Secondary structure | |||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||
| Turn | 492 – 494 | 3 | |||||||||||||||||
| Beta strand | 504 – 507 | 4 | |||||||||||||||||
| Helix | 512 – 514 | 3 | |||||||||||||||||
| Beta strand | 515 – 517 | 3 | |||||||||||||||||
| Helix | 530 – 538 | 9 | |||||||||||||||||
| Turn | 539 – 542 | 4 | |||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes." Hakimi M.-A., Bochar D.A., Chenoweth J., Lane W.S., Mandel G., Shiekhattar R. Proc. Natl. Acad. Sci. U.S.A. 99:7420-7425(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1, TISSUE SPECIFICITY, VARIANT HIS-347. |
| [2] | "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O. DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-456 (ISOFORM 3), VARIANT HIS-347. Tissue: Embryo and Teratocarcinoma. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Uterus. |
| [6] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 121-680 (ISOFORM 1). Tissue: Fetal kidney. |
| [7] | "A novel gene expressed in human bone marrow." Zhao M., Song H., Li N., Peng Y., Han Z., Chen Z. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 284-672 (ISOFORMS 2/3). Tissue: Bone marrow. |
| [8] | "A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes." Hakimi M.-A., Dong Y., Lane W.S., Speicher D.W., Shiekhattar R. J. Biol. Chem. 278:7234-7239(2003) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A; RCOR1; ZMYM2; ZNF217; ZMYM3; KIAA0182 AND GTF2I. |
| [9] | "Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression." Iwase S., Januma A., Miyamoto K., Shono N., Honda A., Yanagisawa J., Baba T. Biochem. Biophys. Res. Commun. 322:601-608(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1. |
| [10] | "Regulation of LSD1 histone demethylase activity by its associated factors." Shi Y.-J., Matson C., Lan F., Iwase S., Baba T., Shi Y. Mol. Cell 19:857-864(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [11] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [12] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-444 AND SER-447, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [15] | "Solution structure of the PHD domain in PHD finger protein 21A." RIKEN structural genomics initiative (RSGI) Submitted (MAR-2008) to the PDB data bank Cited for: STRUCTURE BY NMR OF 487-535. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AY090777 mRNA. Translation: AAM09095.1. AB051483 mRNA. Translation: BAB21787.1. Different initiation. AK021530 mRNA. Translation: BAB13839.1. AK023258 mRNA. Translation: BAB14492.1. CH471064 Genomic DNA. Translation: EAW68012.1. CH471064 Genomic DNA. Translation: EAW68013.1. CH471064 Genomic DNA. Translation: EAW68015.1. CH471064 Genomic DNA. Translation: EAW68017.1. BC015714 mRNA. Translation: AAH15714.1. BX648236 mRNA. Translation: CAH10542.1. AF208848 mRNA. Translation: AAF64262.1. Frameshift. | ||||||||||||||||||
| IPI | IPI00041959. IPI00054460. IPI00737174. | ||||||||||||||||||
| RefSeq | NP_001095272.1. NM_001101802.1. NP_057705.3. NM_016621.3. | ||||||||||||||||||
| UniGene | Hs.502458. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q96BD5. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| IntAct | Q96BD5. 7 interactions. | ||||||||||||||||||
| MINT | MINT-1469147. | ||||||||||||||||||
| STRING | 9606.ENSP00000398824. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q96BD5. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 74731224. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q96BD5. | ||||||||||||||||||
| PRIDE | Q96BD5. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| DNASU | 51317. | ||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000257821; ENSP00000257821; ENSG00000135365. ENST00000323180; ENSP00000323152; ENSG00000135365. ENST00000418153; ENSP00000398824; ENSG00000135365. | ||||||||||||||||||
| GeneID | 51317. | ||||||||||||||||||
| KEGG | hsa:51317. | ||||||||||||||||||
| UCSC | uc001ncb.4. human. uc001ncc.4. human. uc001nce.2. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 51317. | ||||||||||||||||||
| GeneCards | GC11M045950. | ||||||||||||||||||
| HGNC | HGNC:24156. PHF21A. | ||||||||||||||||||
| HPA | HPA023580. | ||||||||||||||||||
| MIM | 608325. gene. | ||||||||||||||||||
| neXtProt | NX_Q96BD5. | ||||||||||||||||||
| Orphanet | 52022. Potocki-Shaffer syndrome. | ||||||||||||||||||
| PharmGKB | PA134977844. | ||||||||||||||||||
| HUGE | Search... | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | NOG310379. | ||||||||||||||||||
| HOVERGEN | HBG080293. | ||||||||||||||||||
| InParanoid | Q96BD5. | ||||||||||||||||||
| OMA | SCTVNCN. | ||||||||||||||||||
| OrthoDB | EOG4KWJSH. | ||||||||||||||||||
| PhylomeDB | Q96BD5. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_604. Hemostasis. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q96BD5. | ||||||||||||||||||
| Bgee | Q96BD5. | ||||||||||||||||||
| CleanEx | HS_PHF21A. | ||||||||||||||||||
| Genevestigator | Q96BD5. | ||||||||||||||||||
| GermOnline | ENSG00000135365. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| Gene3D | 3.30.40.10. 1 hit. | ||||||||||||||||||
| InterPro | IPR017956. AT_hook_DNA-bd_motif. IPR019786. Zinc_finger_PHD-type_CS. IPR011011. Znf_FYVE_PHD. IPR001965. Znf_PHD. IPR019787. Znf_PHD-finger. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. [Graphical view] | ||||||||||||||||||
| Pfam | PF02178. AT_hook. 1 hit. PF00628. PHD. 1 hit. [Graphical view] | ||||||||||||||||||
| SMART | SM00384. AT_hook. 1 hit. SM00249. PHD. 1 hit. SM00184. RING. 1 hit. [Graphical view] | ||||||||||||||||||
| SUPFAM | SSF57903. FYVE_PHD_ZnF. 1 hit. | ||||||||||||||||||
| PROSITE | PS01359. ZF_PHD_1. 1 hit. PS50016. ZF_PHD_2. 1 hit. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| EvolutionaryTrace | Q96BD5. | ||||||||||||||||||
| GenomeRNAi | 51317. | ||||||||||||||||||
| NextBio | 54681. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | PF21A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96BD5 Secondary accession number(s): D3DQP5 Q9NZE9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
