Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96BD5

- PF21A_HUMAN

UniProt

Q96BD5 - PF21A_HUMAN

Protein

PHD finger protein 21A

Gene

PHF21A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 116 (01 Oct 2014)
      Sequence version 1 (01 Dec 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation.1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    DNA bindingi425 – 43713A.T hookAdd
    BLAST
    Zinc fingeri488 – 53548PHD-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. chromatin binding Source: Ensembl
    2. DNA binding Source: UniProtKB-KW
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. blood coagulation Source: Reactome
    2. chromatin modification Source: UniProtKB-KW
    3. negative regulation of transcription from RNA polymerase II promoter Source: MGI
    4. regulation of transcription, DNA-templated Source: UniProtKB-KW
    5. suckling behavior Source: Ensembl
    6. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Chromatin regulator, Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding, Metal-binding, Zinc

    Enzyme and pathway databases

    ReactomeiREACT_24970. Factors involved in megakaryocyte development and platelet production.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    PHD finger protein 21A
    Alternative name(s):
    BHC80a
    BRAF35-HDAC complex protein BHC80
    Gene namesi
    Name:PHF21A
    Synonyms:BHC80, KIAA1696
    ORF Names:BM-006
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 11

    Organism-specific databases

    HGNCiHGNC:24156. PHF21A.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. histone deacetylase complex Source: MGI
    2. nucleoplasm Source: Reactome

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    Orphaneti52022. Potocki-Shaffer syndrome.
    PharmGKBiPA134977844.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 680680PHD finger protein 21APRO_0000226767Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei444 – 4441Phosphothreonine1 Publication
    Modified residuei447 – 4471Phosphoserine1 Publication

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ96BD5.
    PaxDbiQ96BD5.
    PRIDEiQ96BD5.

    PTM databases

    PhosphoSiteiQ96BD5.

    Expressioni

    Tissue specificityi

    Highly expressed in brain. Expressed at much lower level in other tissues.1 Publication

    Gene expression databases

    ArrayExpressiQ96BD5.
    BgeeiQ96BD5.
    CleanExiHS_PHF21A.
    GenevestigatoriQ96BD5.

    Organism-specific databases

    HPAiHPA023580.

    Interactioni

    Subunit structurei

    Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST.3 Publications

    Protein-protein interaction databases

    BioGridi119468. 13 interactions.
    DIPiDIP-60252N.
    IntActiQ96BD5. 9 interactions.
    MINTiMINT-1469147.
    STRINGi9606.ENSP00000398824.

    Structurei

    Secondary structure

    1
    680
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Turni492 – 4943
    Beta strandi504 – 5074
    Helixi512 – 5143
    Beta strandi515 – 5173
    Helixi530 – 5389
    Turni539 – 5424

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2PUYX-ray1.43A/B486-543[»]
    2YQLNMR-A487-535[»]
    ProteinModelPortaliQ96BD5.
    SMRiQ96BD5. Positions 486-543.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ96BD5.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni486 – 680195Required for transcriptional repressionAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili558 – 60346Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi4 – 108105Gln-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 A.T hook DNA-binding domain.Curated
    Contains 1 PHD-type zinc finger.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri488 – 53548PHD-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Coiled coil, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG310379.
    HOVERGENiHBG080293.
    InParanoidiQ96BD5.
    OMAiHHHAQSA.
    OrthoDBiEOG7WMCHZ.
    PhylomeDBiQ96BD5.
    TreeFamiTF331518.

    Family and domain databases

    Gene3Di3.30.40.10. 1 hit.
    InterProiIPR017956. AT_hook_DNA-bd_motif.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF02178. AT_hook. 1 hit.
    PF00628. PHD. 1 hit.
    [Graphical view]
    SMARTiSM00384. AT_hook. 1 hit.
    SM00249. PHD. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view]
    SUPFAMiSSF57903. SSF57903. 1 hit.
    PROSITEiPS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q96BD5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK    50
    QKRVVEQLRK NLIVKQEQPD KFQIQPLPQS ENKLQTAQQQ PLQQLQQQQQ 100
    YHHHHAQQSA AASPNLTASQ KTVTTASMIT TKTLPLVLKA ATATMPASVV 150
    GQRPTIAMVT AINSQKAVLS TDVQNTPVNL QTSSKVTGPG AEAVQIVAKN 200
    TVTLVQATPP QPIKVPQFIP PPRLTPRPNF LPQVRPKPVA QNNIPIAPAP 250
    PPMLAAPQLI QRPVMLTKFT PTTLPTSQNS IHPVRVVNGQ TATIAKTFPM 300
    AQLTSIVIAT PGTRLAGPQT VQLSKPSLEK QTVKSHTETD EKQTESRTIT 350
    PPAAPKPKRE ENPQKLAFMV SLGLVTHDHL EEIQSKRQER KRRTTANPVY 400
    SGAVFEPERK KSAVTYLNST MHPGTRKRGR PPKYNAVLGF GALTPTSPQS 450
    SHPDSPENEK TETTFTFPAP VQPVSLPSPT STDGDIHEDF CSVCRKSGQL 500
    LMCDTCSRVY HLDCLDPPLK TIPKGMWICP RCQDQMLKKE EAIPWPGTLA 550
    IVHSYIAYKA AKEEEKQKLL KWSSDLKQER EQLEQKVKQL SNSISKCMEM 600
    KNTILARQKE MHSSLEKVKQ LIRLIHGIDL SKPVDSEATV GAISNGPDCT 650
    PPANAATSTP APSPSSQSCT ANCNQGEETK 680
    Length:680
    Mass (Da):74,854
    Last modified:December 1, 2001 - v1
    Checksum:iC7AF87EB2984A796
    GO
    Isoform 2 (identifier: Q96BD5-2) [UniParc]FASTAAdd to Basket

    Also known as: hBHC80-4

    The sequence of this isoform differs from the canonical sequence as follows:
         204-204: L → LQ
         429-483: GRPPKYNAVLGFGALTPTSPQSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

    Show »
    Length:634
    Mass (Da):70,210
    Checksum:iB1F247CD92D7D411
    GO
    Isoform 3 (identifier: Q96BD5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         204-204: L → LQ

    Show »
    Length:681
    Mass (Da):74,982
    Checksum:iF95DC57A1D3C0FEC
    GO

    Sequence cautioni

    The sequence AAF64262.1 differs from that shown. Reason: Frameshift at several positions.
    The sequence BAB21787.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti447 – 4471S → P in BAB13839. (PubMed:14702039)Curated
    Sequence conflicti662 – 68019PSPSS…GEETK → LCSLPELHSEL1 PublicationCuratedAdd
    BLAST

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti347 – 3471R → H.2 Publications
    Corresponds to variant rs3736508 [ dbSNP | Ensembl ].
    VAR_025515

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei204 – 2041L → LQ in isoform 2 and isoform 3. 3 PublicationsVSP_017448
    Alternative sequencei429 – 48355GRPPK…PTSTD → ANEEHWPK in isoform 2. 3 PublicationsVSP_017449Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY090777 mRNA. Translation: AAM09095.1.
    AB051483 mRNA. Translation: BAB21787.1. Different initiation.
    AK021530 mRNA. Translation: BAB13839.1.
    AK023258 mRNA. Translation: BAB14492.1.
    CH471064 Genomic DNA. Translation: EAW68012.1.
    CH471064 Genomic DNA. Translation: EAW68013.1.
    CH471064 Genomic DNA. Translation: EAW68015.1.
    CH471064 Genomic DNA. Translation: EAW68017.1.
    BC015714 mRNA. Translation: AAH15714.1.
    BX648236 mRNA. Translation: CAH10542.1.
    AF208848 mRNA. Translation: AAF64262.1. Frameshift.
    CCDSiCCDS31474.1. [Q96BD5-2]
    CCDS44578.1. [Q96BD5-1]
    RefSeqiNP_001095272.1. NM_001101802.1. [Q96BD5-1]
    NP_057705.3. NM_016621.3. [Q96BD5-2]
    XP_005253019.1. XM_005252962.2. [Q96BD5-3]
    XP_005253020.1. XM_005252963.2. [Q96BD5-3]
    XP_005253021.1. XM_005252964.2. [Q96BD5-3]
    XP_005253022.1. XM_005252965.2. [Q96BD5-3]
    UniGeneiHs.502458.

    Genome annotation databases

    EnsembliENST00000323180; ENSP00000323152; ENSG00000135365. [Q96BD5-2]
    ENST00000418153; ENSP00000398824; ENSG00000135365. [Q96BD5-1]
    GeneIDi51317.
    KEGGihsa:51317.
    UCSCiuc001ncb.4. human. [Q96BD5-2]
    uc001ncc.4. human. [Q96BD5-1]
    uc001nce.2. human. [Q96BD5-3]

    Polymorphism databases

    DMDMi74731224.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY090777 mRNA. Translation: AAM09095.1 .
    AB051483 mRNA. Translation: BAB21787.1 . Different initiation.
    AK021530 mRNA. Translation: BAB13839.1 .
    AK023258 mRNA. Translation: BAB14492.1 .
    CH471064 Genomic DNA. Translation: EAW68012.1 .
    CH471064 Genomic DNA. Translation: EAW68013.1 .
    CH471064 Genomic DNA. Translation: EAW68015.1 .
    CH471064 Genomic DNA. Translation: EAW68017.1 .
    BC015714 mRNA. Translation: AAH15714.1 .
    BX648236 mRNA. Translation: CAH10542.1 .
    AF208848 mRNA. Translation: AAF64262.1 . Frameshift.
    CCDSi CCDS31474.1. [Q96BD5-2 ]
    CCDS44578.1. [Q96BD5-1 ]
    RefSeqi NP_001095272.1. NM_001101802.1. [Q96BD5-1 ]
    NP_057705.3. NM_016621.3. [Q96BD5-2 ]
    XP_005253019.1. XM_005252962.2. [Q96BD5-3 ]
    XP_005253020.1. XM_005252963.2. [Q96BD5-3 ]
    XP_005253021.1. XM_005252964.2. [Q96BD5-3 ]
    XP_005253022.1. XM_005252965.2. [Q96BD5-3 ]
    UniGenei Hs.502458.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2PUY X-ray 1.43 A/B 486-543 [» ]
    2YQL NMR - A 487-535 [» ]
    ProteinModelPortali Q96BD5.
    SMRi Q96BD5. Positions 486-543.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119468. 13 interactions.
    DIPi DIP-60252N.
    IntActi Q96BD5. 9 interactions.
    MINTi MINT-1469147.
    STRINGi 9606.ENSP00000398824.

    PTM databases

    PhosphoSitei Q96BD5.

    Polymorphism databases

    DMDMi 74731224.

    Proteomic databases

    MaxQBi Q96BD5.
    PaxDbi Q96BD5.
    PRIDEi Q96BD5.

    Protocols and materials databases

    DNASUi 51317.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000323180 ; ENSP00000323152 ; ENSG00000135365 . [Q96BD5-2 ]
    ENST00000418153 ; ENSP00000398824 ; ENSG00000135365 . [Q96BD5-1 ]
    GeneIDi 51317.
    KEGGi hsa:51317.
    UCSCi uc001ncb.4. human. [Q96BD5-2 ]
    uc001ncc.4. human. [Q96BD5-1 ]
    uc001nce.2. human. [Q96BD5-3 ]

    Organism-specific databases

    CTDi 51317.
    GeneCardsi GC11M045950.
    HGNCi HGNC:24156. PHF21A.
    HPAi HPA023580.
    MIMi 608325. gene.
    neXtProti NX_Q96BD5.
    Orphaneti 52022. Potocki-Shaffer syndrome.
    PharmGKBi PA134977844.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG310379.
    HOVERGENi HBG080293.
    InParanoidi Q96BD5.
    OMAi HHHAQSA.
    OrthoDBi EOG7WMCHZ.
    PhylomeDBi Q96BD5.
    TreeFami TF331518.

    Enzyme and pathway databases

    Reactomei REACT_24970. Factors involved in megakaryocyte development and platelet production.

    Miscellaneous databases

    EvolutionaryTracei Q96BD5.
    GeneWikii PHF21A.
    GenomeRNAii 51317.
    NextBioi 54681.
    PROi Q96BD5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96BD5.
    Bgeei Q96BD5.
    CleanExi HS_PHF21A.
    Genevestigatori Q96BD5.

    Family and domain databases

    Gene3Di 3.30.40.10. 1 hit.
    InterProi IPR017956. AT_hook_DNA-bd_motif.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR001841. Znf_RING.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF02178. AT_hook. 1 hit.
    PF00628. PHD. 1 hit.
    [Graphical view ]
    SMARTi SM00384. AT_hook. 1 hit.
    SM00249. PHD. 1 hit.
    SM00184. RING. 1 hit.
    [Graphical view ]
    SUPFAMi SSF57903. SSF57903. 1 hit.
    PROSITEi PS01359. ZF_PHD_1. 1 hit.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A core-BRAF35 complex containing histone deacetylase mediates repression of neuronal-specific genes."
      Hakimi M.-A., Bochar D.A., Chenoweth J., Lane W.S., Mandel G., Shiekhattar R.
      Proc. Natl. Acad. Sci. U.S.A. 99:7420-7425(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1, TISSUE SPECIFICITY, VARIANT HIS-347.
    2. "Prediction of the coding sequences of unidentified human genes. XIX. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Hattori A., Kondo Y., Okumura K., Ohara O.
      DNA Res. 7:347-355(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 1-456 (ISOFORM 3), VARIANT HIS-347.
      Tissue: Embryo and Teratocarcinoma.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Uterus.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 121-680 (ISOFORM 1).
      Tissue: Fetal kidney.
    7. "A novel gene expressed in human bone marrow."
      Zhao M., Song H., Li N., Peng Y., Han Z., Chen Z.
      Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 284-672 (ISOFORMS 2/3).
      Tissue: Bone marrow.
    8. "A candidate X-linked mental retardation gene is a component of a new family of histone deacetylase-containing complexes."
      Hakimi M.-A., Dong Y., Lane W.S., Speicher D.W., Shiekhattar R.
      J. Biol. Chem. 278:7234-7239(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, IDENTIFICATION IN THE BHC COMPLEX WITH HDAC1; HDAC2; HMG20B; KDM1A; RCOR1; ZMYM2; ZNF217; ZMYM3; KIAA0182 AND GTF2I.
    9. "Characterization of BHC80 in BRAF-HDAC complex, involved in neuron-specific gene repression."
      Iwase S., Januma A., Miyamoto K., Shono N., Honda A., Yanagisawa J., Baba T.
      Biochem. Biophys. Res. Commun. 322:601-608(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH HDAC1; HDAC2; HMG20B; KDM1A AND RCOR1.
    10. "Regulation of LSD1 histone demethylase activity by its associated factors."
      Shi Y.-J., Matson C., Lan F., Iwase S., Baba T., Shi Y.
      Mol. Cell 19:857-864(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-444 AND SER-447, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. "Solution structure of the PHD domain in PHD finger protein 21A."
      RIKEN structural genomics initiative (RSGI)
      Submitted (MAR-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 487-535.

    Entry informationi

    Entry nameiPF21A_HUMAN
    AccessioniPrimary (citable) accession number: Q96BD5
    Secondary accession number(s): D3DQP5
    , Q6AWA2, Q9C0G7, Q9H8V9, Q9HAK6, Q9NZE9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 7, 2006
    Last sequence update: December 1, 2001
    Last modified: October 1, 2014
    This is version 116 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 11
      Human chromosome 11: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3