SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96BD0

- SO4A1_HUMAN

UniProt

Q96BD0 - SO4A1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Solute carrier organic anion transporter family member 4A1
Gene
SLCO4A1, OATP1, OATP4A1, OATPE, SLC21A12
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

GO - Molecular functioni

  1. transporter activity Source: InterPro
Complete GO annotation...

GO - Biological processi

  1. sodium-independent organic anion transport Source: Reactome
  2. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_23988. Transport of organic anions.

Protein family/group databases

TCDBi2.A.60.1.9. the organo anion transporter (oat) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 4A1
Short name:
OATP4A1
Alternative name(s):
Colon organic anion transporter
Organic anion transporter polypeptide-related protein 1
Short name:
OATP-RP1
Short name:
OATPRP1
Short name:
POAT
Organic anion-transporting polypeptide E
Short name:
OATP-E
Sodium-independent organic anion transporter E
Solute carrier family 21 member 12
Gene namesi
Name:SLCO4A1
Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:10953. SLCO4A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 103103Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei104 – 12421Helical; Name=1; Reviewed prediction
Add
BLAST
Topological domaini125 – 14319Extracellular Reviewed prediction
Add
BLAST
Transmembranei144 – 16421Helical; Name=2; Reviewed prediction
Add
BLAST
Topological domaini165 – 1706Cytoplasmic Reviewed prediction
Transmembranei171 – 19525Helical; Name=3; Reviewed prediction
Add
BLAST
Topological domaini196 – 22227Extracellular Reviewed prediction
Add
BLAST
Transmembranei223 – 25331Helical; Name=4; Reviewed prediction
Add
BLAST
Topological domaini254 – 27219Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei273 – 29321Helical; Name=5; Reviewed prediction
Add
BLAST
Topological domaini294 – 30714Extracellular Reviewed prediction
Add
BLAST
Transmembranei308 – 33225Helical; Name=6; Reviewed prediction
Add
BLAST
Topological domaini333 – 37846Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei379 – 40022Helical; Name=7; Reviewed prediction
Add
BLAST
Topological domaini401 – 42020Extracellular Reviewed prediction
Add
BLAST
Transmembranei421 – 44424Helical; Name=8; Reviewed prediction
Add
BLAST
Topological domaini445 – 4484Cytoplasmic Reviewed prediction
Transmembranei449 – 47123Helical; Name=9; Reviewed prediction
Add
BLAST
Topological domaini472 – 580109Extracellular Reviewed prediction
Add
BLAST
Transmembranei581 – 60323Helical; Name=10; Reviewed prediction
Add
BLAST
Topological domaini604 – 6129Cytoplasmic Reviewed prediction
Transmembranei613 – 63826Helical; Name=11; Reviewed prediction
Add
BLAST
Topological domaini639 – 67133Extracellular Reviewed prediction
Add
BLAST
Transmembranei672 – 68918Helical; Name=12; Reviewed prediction
Add
BLAST
Topological domaini690 – 72233Cytoplasmic Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35838.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 722722Solute carrier organic anion transporter family member 4A1
PRO_0000191067Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341Phosphoserine1 Publication
Modified residuei37 – 371Phosphothreonine1 Publication
Modified residuei40 – 401Phosphoserine2 Publications
Modified residuei43 – 431Phosphoserine2 Publications
Modified residuei46 – 461Phosphoserine2 Publications
Modified residuei50 – 501Phosphoserine2 Publications
Glycosylationi499 – 4991N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi504 ↔ 530 By similarity
Disulfide bondi508 ↔ 519 By similarity
Disulfide bondi510 ↔ 534 By similarity
Glycosylationi557 – 5571N-linked (GlcNAc...) Reviewed prediction

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96BD0.
PaxDbiQ96BD0.
PRIDEiQ96BD0.

PTM databases

PhosphoSiteiQ96BD0.

Expressioni

Tissue specificityi

Ubiquitous, with the exception of spleen and leukocytes.

Gene expression databases

ArrayExpressiQ96BD0.
BgeeiQ96BD0.
CleanExiHS_SLCO4A1.
GenevestigatoriQ96BD0.

Organism-specific databases

HPAiHPA030669.
HPA030670.

Interactioni

Protein-protein interaction databases

BioGridi118180. 1 interaction.
IntActiQ96BD0. 1 interaction.
STRINGi9606.ENSP00000217159.

Structurei

3D structure databases

ProteinModelPortaliQ96BD0.
SMRiQ96BD0. Positions 507-537, 601-641.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini498 – 55558Kazal-like
Add
BLAST

Sequence similaritiesi

Contains 1 Kazal-like domain.

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG320775.
HOVERGENiHBG100565.
InParanoidiQ96BD0.
KOiK14354.
OMAiFKLRCSG.
PhylomeDBiQ96BD0.
TreeFamiTF317540.

Family and domain databases

InterProiIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004156. OA_transporter.
[Graphical view]
PANTHERiPTHR11388. PTHR11388. 1 hit.
PfamiPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
TIGRFAMsiTIGR00805. oat. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q96BD0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS    50
PLDTSKQPLC QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN 100
TPKGILFFLC AAAFLQGMTV NGFINTVITS LERRYDLHSY QSGLIASSYD 150
IAACLCLTFV SYFGGSGHKP RWLGWGVLLM GTGSLVFALP HFTAGRYEVE 200
LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG ATPLYTLGVT 250
YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT 300
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH 350
QLKDSSRGEA SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT 400
GMSTFSPKFL ESQFSLSASE AATLFGYLVV PAGGGGTFLG GFFVNKLRLR 450
GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP MAGVTASYGG SLLPEGHLNL 500
TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET NVDGQKVYRD 550
CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT 600
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG 650
QQGSCLVYQN SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE 700
TCLPSQSSAP DSATDSQLQS SV 722
Length:722
Mass (Da):77,193
Last modified:January 10, 2003 - v2
Checksum:iDD8F0C10E4BCD255
GO
Isoform 2 (identifier: Q96BD0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
     686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST

Show »
Length:583
Mass (Da):62,325
Checksum:i67342B00D99DCB31
GO
Isoform 3 (identifier: Q96BD0-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
     662-722: Missing.

Show »
Length:661
Mass (Da):70,454
Checksum:i39E50AB1FC24B071
GO
Isoform 4 (identifier: Q96BD0-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

Show »
Length:722
Mass (Da):77,084
Checksum:i8A5B9415E0B1CB63
GO

Sequence cautioni

The sequence BAA91247.1 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti70 – 701R → Q.
Corresponds to variant rs34419428 [ dbSNP | Ensembl ].
VAR_053678
Natural varianti78 – 781V → I.1 Publication
Corresponds to variant rs1047099 [ dbSNP | Ensembl ].
VAR_053679

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei250 – 410161TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2.
VSP_006152Add
BLAST
Alternative sequencei548 – 661114YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3.
VSP_006153Add
BLAST
Alternative sequencei572 – 60332STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4.
VSP_006154Add
BLAST
Alternative sequencei662 – 72261Missing in isoform 3.
VSP_006155Add
BLAST
Alternative sequencei686 – 72237CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2.
VSP_006156Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti246 – 2461T → M in BAB14566. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB031051 mRNA. Translation: BAA89288.1.
AF187817 mRNA. Translation: AAG43447.1.
AF104334 mRNA. Translation: AAF15545.1.
AF205072 mRNA. Translation: AAG42204.1.
AK023410 mRNA. Translation: BAB14566.1.
AK000551 mRNA. Translation: BAA91247.1. Different initiation.
AL357033 Genomic DNA. Translation: CAC14920.1.
AL357033 Genomic DNA. Translation: CAC14921.1.
BC015727 mRNA. Translation: AAH15727.1.
CCDSiCCDS13501.1. [Q96BD0-1]
RefSeqiNP_057438.3. NM_016354.3. [Q96BD0-1]
UniGeneiHs.235782.

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
GeneIDi28231.
KEGGihsa:28231.
UCSCiuc002ydb.1. human. [Q96BD0-1]

Polymorphism databases

DMDMi27734555.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB031051 mRNA. Translation: BAA89288.1 .
AF187817 mRNA. Translation: AAG43447.1 .
AF104334 mRNA. Translation: AAF15545.1 .
AF205072 mRNA. Translation: AAG42204.1 .
AK023410 mRNA. Translation: BAB14566.1 .
AK000551 mRNA. Translation: BAA91247.1 . Different initiation.
AL357033 Genomic DNA. Translation: CAC14920.1 .
AL357033 Genomic DNA. Translation: CAC14921.1 .
BC015727 mRNA. Translation: AAH15727.1 .
CCDSi CCDS13501.1. [Q96BD0-1 ]
RefSeqi NP_057438.3. NM_016354.3. [Q96BD0-1 ]
UniGenei Hs.235782.

3D structure databases

ProteinModelPortali Q96BD0.
SMRi Q96BD0. Positions 507-537, 601-641.
ModBasei Search...

Protein-protein interaction databases

BioGridi 118180. 1 interaction.
IntActi Q96BD0. 1 interaction.
STRINGi 9606.ENSP00000217159.

Chemistry

ChEMBLi CHEMBL2073679.
GuidetoPHARMACOLOGYi 1226.

Protein family/group databases

TCDBi 2.A.60.1.9. the organo anion transporter (oat) family.

PTM databases

PhosphoSitei Q96BD0.

Polymorphism databases

DMDMi 27734555.

Proteomic databases

MaxQBi Q96BD0.
PaxDbi Q96BD0.
PRIDEi Q96BD0.

Protocols and materials databases

DNASUi 28231.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000217159 ; ENSP00000217159 ; ENSG00000101187 . [Q96BD0-1 ]
ENST00000370507 ; ENSP00000359538 ; ENSG00000101187 . [Q96BD0-1 ]
GeneIDi 28231.
KEGGi hsa:28231.
UCSCi uc002ydb.1. human. [Q96BD0-1 ]

Organism-specific databases

CTDi 28231.
GeneCardsi GC20P061273.
H-InvDB HIX0015985.
HIX0138058.
HGNCi HGNC:10953. SLCO4A1.
HPAi HPA030669.
HPA030670.
MIMi 612436. gene.
neXtProti NX_Q96BD0.
PharmGKBi PA35838.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG320775.
HOVERGENi HBG100565.
InParanoidi Q96BD0.
KOi K14354.
OMAi FKLRCSG.
PhylomeDBi Q96BD0.
TreeFami TF317540.

Enzyme and pathway databases

Reactomei REACT_23988. Transport of organic anions.

Miscellaneous databases

ChiTaRSi SLCO4A1. human.
GeneWikii SLCO4A1.
GenomeRNAii 28231.
NextBioi 50544.
PROi Q96BD0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96BD0.
Bgeei Q96BD0.
CleanExi HS_SLCO4A1.
Genevestigatori Q96BD0.

Family and domain databases

InterProi IPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004156. OA_transporter.
[Graphical view ]
PANTHERi PTHR11388. PTHR11388. 1 hit.
Pfami PF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view ]
SMARTi SM00280. KAZAL. 1 hit.
[Graphical view ]
SUPFAMi SSF103473. SSF103473. 3 hits.
TIGRFAMsi TIGR00805. oat. 1 hit.
PROSITEi PS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family."
    Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A.
    Biochem. Biophys. Res. Commun. 273:251-260(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  2. "Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner."
    Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M., Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K., Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S., Matsuno S., Abe T.
    Endocrinology 142:2005-2012(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  3. "Molecular cloning of a putative organic anion transporter, POAT."
    Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L.
    Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3).
  4. "Identification and characterization of novel human OATP family members."
    Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G.
    Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ILE-78.
    Tissue: Ovarian carcinoma.
  6. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiSO4A1_HUMAN
AccessioniPrimary (citable) accession number: Q96BD0
Secondary accession number(s): Q9H4T7
, Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 10, 2003
Last modified: September 3, 2014
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi