Q96BD0 (SO4A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 112.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Solute carrier organic anion transporter family member 4A1 Short name=OATP4A1 Alternative name(s): Colon organic anion transporter Organic anion transporter polypeptide-related protein 1 Short name=OATP-RP1 Short name=OATPRP1 Short name=POAT Organic anion-transporting polypeptide E Short name=OATP-E Sodium-independent organic anion transporter E Solute carrier family 21 member 12 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 722 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate. |
| Subcellular location | |
| Tissue specificity | Ubiquitous, with the exception of spleen and leukocytes. |
| Sequence similarities | Belongs to the organo anion transporter (TC 2.A.60) family. [View classification] Contains 1 Kazal-like domain. |
| Sequence caution | The sequence BAA91247.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport |
| Cellular component | Cell membrane Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Disulfide bond Glycoprotein Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | sodium-independent organic anion transport Traceable author statement. Source: Reactome transmembrane transportTraceable author statement. Source: Reactome |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | transporter activity Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q96BD0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q96BD0-2) The sequence of this isoform differs from the canonical sequence as follows: 250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS 686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST | ||||||
| Isoform 3 (identifier: Q96BD0-3) The sequence of this isoform differs from the canonical sequence as follows: 548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS 662-722: Missing. | ||||||
| Isoform 4 (identifier: Q96BD0-4) The sequence of this isoform differs from the canonical sequence as follows: 572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 722 | 722 | Solute carrier organic anion transporter family member 4A1 | PRO_0000191067 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 103 | 103 | Cytoplasmic Potential | ||||||||
| Transmembrane | 104 – 124 | 21 | Helical; Name=1; Potential | ||||||||
| Topological domain | 125 – 143 | 19 | Extracellular Potential | ||||||||
| Transmembrane | 144 – 164 | 21 | Helical; Name=2; Potential | ||||||||
| Topological domain | 165 – 170 | 6 | Cytoplasmic Potential | ||||||||
| Transmembrane | 171 – 195 | 25 | Helical; Name=3; Potential | ||||||||
| Topological domain | 196 – 222 | 27 | Extracellular Potential | ||||||||
| Transmembrane | 223 – 253 | 31 | Helical; Name=4; Potential | ||||||||
| Topological domain | 254 – 272 | 19 | Cytoplasmic Potential | ||||||||
| Transmembrane | 273 – 293 | 21 | Helical; Name=5; Potential | ||||||||
| Topological domain | 294 – 307 | 14 | Extracellular Potential | ||||||||
| Transmembrane | 308 – 332 | 25 | Helical; Name=6; Potential | ||||||||
| Topological domain | 333 – 378 | 46 | Cytoplasmic Potential | ||||||||
| Transmembrane | 379 – 400 | 22 | Helical; Name=7; Potential | ||||||||
| Topological domain | 401 – 420 | 20 | Extracellular Potential | ||||||||
| Transmembrane | 421 – 444 | 24 | Helical; Name=8; Potential | ||||||||
| Topological domain | 445 – 448 | 4 | Cytoplasmic Potential | ||||||||
| Transmembrane | 449 – 471 | 23 | Helical; Name=9; Potential | ||||||||
| Topological domain | 472 – 580 | 109 | Extracellular Potential | ||||||||
| Transmembrane | 581 – 603 | 23 | Helical; Name=10; Potential | ||||||||
| Topological domain | 604 – 612 | 9 | Cytoplasmic Potential | ||||||||
| Transmembrane | 613 – 638 | 26 | Helical; Name=11; Potential | ||||||||
| Topological domain | 639 – 671 | 33 | Extracellular Potential | ||||||||
| Transmembrane | 672 – 689 | 18 | Helical; Name=12; Potential | ||||||||
| Topological domain | 690 – 722 | 33 | Cytoplasmic Potential | ||||||||
| Domain | 498 – 555 | 58 | Kazal-like | ||||||||
Amino acid modifications | |||||||||||
| Modified residue | 34 | 1 | Phosphoserine Ref.9 | ||||||||
| Modified residue | 37 | 1 | Phosphothreonine Ref.9 | ||||||||
| Modified residue | 40 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||||
| Modified residue | 43 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||||
| Modified residue | 46 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||||
| Modified residue | 50 | 1 | Phosphoserine Ref.9 Ref.10 | ||||||||
| Glycosylation | 499 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Glycosylation | 557 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 504 ↔ 530 | By similarity | |||||||||
| Disulfide bond | 508 ↔ 519 | By similarity | |||||||||
| Disulfide bond | 510 ↔ 534 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 250 – 410 | 161 | TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2. | VSP_006152 | |||||||
| Alternative sequence | 548 – 661 | 114 | YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3. | VSP_006153 | |||||||
| Alternative sequence | 572 – 603 | 32 | STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4. | VSP_006154 | |||||||
| Alternative sequence | 662 – 722 | 61 | Missing in isoform 3. | VSP_006155 | |||||||
| Alternative sequence | 686 – 722 | 37 | CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2. | VSP_006156 | |||||||
| Natural variant | 70 | 1 | R → Q. Corresponds to variant rs34419428 [ dbSNP | Ensembl ]. | VAR_053678 | |||||||
| Natural variant | 78 | 1 | V → I. Ref.5 Corresponds to variant rs1047099 [ dbSNP | Ensembl ]. | VAR_053679 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 246 | 1 | T → M in BAB14566. Ref.5 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family." Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A. Biochem. Biophys. Res. Commun. 273:251-260(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Kidney. |
| [2] | "Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner." Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M., Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K., Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S., Matsuno S., Abe T. Endocrinology 142:2005-2012(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). Tissue: Hippocampus. |
| [3] | "Molecular cloning of a putative organic anion transporter, POAT." Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L. Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3). |
| [4] | "Identification and characterization of novel human OATP family members." Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G. Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1). |
| [5] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ILE-78. Tissue: Ovarian carcinoma. |
| [6] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [7] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Pancreas. |
| [8] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [9] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40; SER-43; SER-46 AND SER-50, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [10] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND SER-50, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AB031051 mRNA. Translation: BAA89288.1. AF187817 mRNA. Translation: AAG43447.1. AF104334 mRNA. Translation: AAF15545.1. AF205072 mRNA. Translation: AAG42204.1. AK023410 mRNA. Translation: BAB14566.1. AK000551 mRNA. Translation: BAA91247.1. Different initiation. AL357033 Genomic DNA. Translation: CAC14920.1. AL357033 Genomic DNA. Translation: CAC14921.1. BC015727 mRNA. Translation: AAH15727.1. |
| IPI | IPI00039680. IPI00100858. IPI00218821. IPI00873199. |
| RefSeq | NP_057438.3. NM_016354.3. |
| UniGene | Hs.235782. |
3D structure databases | |
| ProteinModelPortal | Q96BD0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q96BD0. 1 interaction. |
| STRING | 9606.ENSP00000217159. |
Protein family/group databases | |
| TCDB | 2.A.60.1.9. organo anion transporter (OAT) family. |
PTM databases | |
| PhosphoSite | Q96BD0. |
Polymorphism databases | |
| DMDM | 27734555. |
Proteomic databases | |
| PaxDb | Q96BD0. |
| PRIDE | Q96BD0. |
Protocols and materials databases | |
| DNASU | 28231. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000217159; ENSP00000217159; ENSG00000101187. ENST00000370507; ENSP00000359538; ENSG00000101187. ENST00000451793; ENSP00000414855; ENSG00000101187. |
| GeneID | 28231. |
| KEGG | hsa:28231. |
| UCSC | uc002ydb.1. human. |
Organism-specific databases | |
| CTD | 28231. |
| GeneCards | GC20P061273. |
| H-InvDB | HIX0015985. HIX0138058. |
| HGNC | HGNC:10953. SLCO4A1. |
| HPA | HPA030669. HPA030670. |
| MIM | 612436. gene. |
| neXtProt | NX_Q96BD0. |
| PharmGKB | PA35838. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG320775. |
| HOVERGEN | HBG100565. |
| InParanoid | Q96BD0. |
| KO | K14354. |
| OMA | FKLRCSG. |
| OrthoDB | EOG41VK2S. |
| PhylomeDB | Q96BD0. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q96BD0. |
| Bgee | Q96BD0. |
| CleanEx | HS_SLCO4A1. |
| Genevestigator | Q96BD0. |
| GermOnline | ENSG00000101187. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR002350. Kazal_dom. IPR020846. MFS_dom. IPR016196. MFS_dom_general_subst_transpt. IPR004156. OA_transporter. [Graphical view] |
| PANTHER | PTHR11388. PTHR11388. 1 hit. |
| Pfam | PF07648. Kazal_2. 1 hit. PF03137. OATP. 1 hit. [Graphical view] |
| SMART | SM00280. KAZAL. 1 hit. [Graphical view] |
| SUPFAM | SSF103473. MFS_gen_substrate_transporter. 1 hit. |
| TIGRFAMs | TIGR00805. oat. 1 hit. |
| PROSITE | PS51465. KAZAL_2. 1 hit. PS50850. MFS. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | SLCO4A1. human. |
| GenomeRNAi | 28231. |
| NextBio | 50544. |
| SOURCE | Search... |
Entry information
| Entry name | SO4A1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96BD0 Secondary accession number(s): Q9H4T7 Q9UIG7 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
