Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q96BD0

- SO4A1_HUMAN

UniProt

Q96BD0 - SO4A1_HUMAN

Protein

Solute carrier organic anion transporter family member 4A1

Gene

SLCO4A1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 2 (10 Jan 2003)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

    GO - Molecular functioni

    1. transporter activity Source: InterPro

    GO - Biological processi

    1. sodium-independent organic anion transport Source: Reactome
    2. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Ion transport, Transport

    Enzyme and pathway databases

    ReactomeiREACT_23988. Transport of organic anions.

    Protein family/group databases

    TCDBi2.A.60.1.9. the organo anion transporter (oat) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Solute carrier organic anion transporter family member 4A1
    Short name:
    OATP4A1
    Alternative name(s):
    Colon organic anion transporter
    Organic anion transporter polypeptide-related protein 1
    Short name:
    OATP-RP1
    Short name:
    OATPRP1
    Short name:
    POAT
    Organic anion-transporting polypeptide E
    Short name:
    OATP-E
    Sodium-independent organic anion transporter E
    Solute carrier family 21 member 12
    Gene namesi
    Name:SLCO4A1
    Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 20

    Organism-specific databases

    HGNCiHGNC:10953. SLCO4A1.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA35838.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 722722Solute carrier organic anion transporter family member 4A1PRO_0000191067Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei34 – 341Phosphoserine1 Publication
    Modified residuei37 – 371Phosphothreonine1 Publication
    Modified residuei40 – 401Phosphoserine2 Publications
    Modified residuei43 – 431Phosphoserine2 Publications
    Modified residuei46 – 461Phosphoserine2 Publications
    Modified residuei50 – 501Phosphoserine2 Publications
    Glycosylationi499 – 4991N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi504 ↔ 530PROSITE-ProRule annotation
    Disulfide bondi508 ↔ 519PROSITE-ProRule annotation
    Disulfide bondi510 ↔ 534PROSITE-ProRule annotation
    Glycosylationi557 – 5571N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ96BD0.
    PaxDbiQ96BD0.
    PRIDEiQ96BD0.

    PTM databases

    PhosphoSiteiQ96BD0.

    Expressioni

    Tissue specificityi

    Ubiquitous, with the exception of spleen and leukocytes.

    Gene expression databases

    ArrayExpressiQ96BD0.
    BgeeiQ96BD0.
    CleanExiHS_SLCO4A1.
    GenevestigatoriQ96BD0.

    Organism-specific databases

    HPAiHPA030669.
    HPA030670.

    Interactioni

    Protein-protein interaction databases

    BioGridi118180. 1 interaction.
    IntActiQ96BD0. 1 interaction.
    STRINGi9606.ENSP00000217159.

    Structurei

    3D structure databases

    ProteinModelPortaliQ96BD0.
    SMRiQ96BD0. Positions 507-537, 601-641.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 103103CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini125 – 14319ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini165 – 1706CytoplasmicSequence Analysis
    Topological domaini196 – 22227ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini254 – 27219CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini294 – 30714ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini333 – 37846CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini401 – 42020ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini445 – 4484CytoplasmicSequence Analysis
    Topological domaini472 – 580109ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini604 – 6129CytoplasmicSequence Analysis
    Topological domaini639 – 67133ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini690 – 72233CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei104 – 12421Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei144 – 16421Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei171 – 19525Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei223 – 25331Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei273 – 29321Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei308 – 33225Helical; Name=6Sequence AnalysisAdd
    BLAST
    Transmembranei379 – 40022Helical; Name=7Sequence AnalysisAdd
    BLAST
    Transmembranei421 – 44424Helical; Name=8Sequence AnalysisAdd
    BLAST
    Transmembranei449 – 47123Helical; Name=9Sequence AnalysisAdd
    BLAST
    Transmembranei581 – 60323Helical; Name=10Sequence AnalysisAdd
    BLAST
    Transmembranei613 – 63826Helical; Name=11Sequence AnalysisAdd
    BLAST
    Transmembranei672 – 68918Helical; Name=12Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini498 – 55558Kazal-likePROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 Kazal-like domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG320775.
    HOVERGENiHBG100565.
    InParanoidiQ96BD0.
    KOiK14354.
    OMAiFKLRCSG.
    PhylomeDBiQ96BD0.
    TreeFamiTF317540.

    Family and domain databases

    InterProiIPR002350. Kazal_dom.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR004156. OA_transporter.
    [Graphical view]
    PANTHERiPTHR11388. PTHR11388. 1 hit.
    PfamiPF07648. Kazal_2. 1 hit.
    PF03137. OATP. 1 hit.
    [Graphical view]
    SMARTiSM00280. KAZAL. 1 hit.
    [Graphical view]
    SUPFAMiSSF103473. SSF103473. 3 hits.
    TIGRFAMsiTIGR00805. oat. 1 hit.
    PROSITEiPS51465. KAZAL_2. 1 hit.
    PS50850. MFS. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Note: Experimental confirmation may be lacking for some isoforms.

    Isoform 1 (identifier: Q96BD0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS    50
    PLDTSKQPLC QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN 100
    TPKGILFFLC AAAFLQGMTV NGFINTVITS LERRYDLHSY QSGLIASSYD 150
    IAACLCLTFV SYFGGSGHKP RWLGWGVLLM GTGSLVFALP HFTAGRYEVE 200
    LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG ATPLYTLGVT 250
    YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT 300
    TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH 350
    QLKDSSRGEA SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT 400
    GMSTFSPKFL ESQFSLSASE AATLFGYLVV PAGGGGTFLG GFFVNKLRLR 450
    GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP MAGVTASYGG SLLPEGHLNL 500
    TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET NVDGQKVYRD 550
    CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT 600
    ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG 650
    QQGSCLVYQN SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE 700
    TCLPSQSSAP DSATDSQLQS SV 722
    Length:722
    Mass (Da):77,193
    Last modified:January 10, 2003 - v2
    Checksum:iDD8F0C10E4BCD255
    GO
    Isoform 2 (identifier: Q96BD0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
         686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST

    Show »
    Length:583
    Mass (Da):62,325
    Checksum:i67342B00D99DCB31
    GO
    Isoform 3 (identifier: Q96BD0-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
         662-722: Missing.

    Show »
    Length:661
    Mass (Da):70,454
    Checksum:i39E50AB1FC24B071
    GO
    Isoform 4 (identifier: Q96BD0-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

    Show »
    Length:722
    Mass (Da):77,084
    Checksum:i8A5B9415E0B1CB63
    GO

    Sequence cautioni

    The sequence BAA91247.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti246 – 2461T → M in BAB14566. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti70 – 701R → Q.
    Corresponds to variant rs34419428 [ dbSNP | Ensembl ].
    VAR_053678
    Natural varianti78 – 781V → I.1 Publication
    Corresponds to variant rs1047099 [ dbSNP | Ensembl ].
    VAR_053679

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei250 – 410161TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2. 1 PublicationVSP_006152Add
    BLAST
    Alternative sequencei548 – 661114YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3. CuratedVSP_006153Add
    BLAST
    Alternative sequencei572 – 60332STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4. 1 PublicationVSP_006154Add
    BLAST
    Alternative sequencei662 – 72261Missing in isoform 3. CuratedVSP_006155Add
    BLAST
    Alternative sequencei686 – 72237CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2. 1 PublicationVSP_006156Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB031051 mRNA. Translation: BAA89288.1.
    AF187817 mRNA. Translation: AAG43447.1.
    AF104334 mRNA. Translation: AAF15545.1.
    AF205072 mRNA. Translation: AAG42204.1.
    AK023410 mRNA. Translation: BAB14566.1.
    AK000551 mRNA. Translation: BAA91247.1. Different initiation.
    AL357033 Genomic DNA. Translation: CAC14920.1.
    AL357033 Genomic DNA. Translation: CAC14921.1.
    BC015727 mRNA. Translation: AAH15727.1.
    CCDSiCCDS13501.1. [Q96BD0-1]
    RefSeqiNP_057438.3. NM_016354.3. [Q96BD0-1]
    UniGeneiHs.235782.

    Genome annotation databases

    EnsembliENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
    ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
    GeneIDi28231.
    KEGGihsa:28231.
    UCSCiuc002ydb.1. human. [Q96BD0-1]

    Polymorphism databases

    DMDMi27734555.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AB031051 mRNA. Translation: BAA89288.1 .
    AF187817 mRNA. Translation: AAG43447.1 .
    AF104334 mRNA. Translation: AAF15545.1 .
    AF205072 mRNA. Translation: AAG42204.1 .
    AK023410 mRNA. Translation: BAB14566.1 .
    AK000551 mRNA. Translation: BAA91247.1 . Different initiation.
    AL357033 Genomic DNA. Translation: CAC14920.1 .
    AL357033 Genomic DNA. Translation: CAC14921.1 .
    BC015727 mRNA. Translation: AAH15727.1 .
    CCDSi CCDS13501.1. [Q96BD0-1 ]
    RefSeqi NP_057438.3. NM_016354.3. [Q96BD0-1 ]
    UniGenei Hs.235782.

    3D structure databases

    ProteinModelPortali Q96BD0.
    SMRi Q96BD0. Positions 507-537, 601-641.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 118180. 1 interaction.
    IntActi Q96BD0. 1 interaction.
    STRINGi 9606.ENSP00000217159.

    Chemistry

    ChEMBLi CHEMBL2073679.
    GuidetoPHARMACOLOGYi 1226.

    Protein family/group databases

    TCDBi 2.A.60.1.9. the organo anion transporter (oat) family.

    PTM databases

    PhosphoSitei Q96BD0.

    Polymorphism databases

    DMDMi 27734555.

    Proteomic databases

    MaxQBi Q96BD0.
    PaxDbi Q96BD0.
    PRIDEi Q96BD0.

    Protocols and materials databases

    DNASUi 28231.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000217159 ; ENSP00000217159 ; ENSG00000101187 . [Q96BD0-1 ]
    ENST00000370507 ; ENSP00000359538 ; ENSG00000101187 . [Q96BD0-1 ]
    GeneIDi 28231.
    KEGGi hsa:28231.
    UCSCi uc002ydb.1. human. [Q96BD0-1 ]

    Organism-specific databases

    CTDi 28231.
    GeneCardsi GC20P061273.
    H-InvDB HIX0015985.
    HIX0138058.
    HGNCi HGNC:10953. SLCO4A1.
    HPAi HPA030669.
    HPA030670.
    MIMi 612436. gene.
    neXtProti NX_Q96BD0.
    PharmGKBi PA35838.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG320775.
    HOVERGENi HBG100565.
    InParanoidi Q96BD0.
    KOi K14354.
    OMAi FKLRCSG.
    PhylomeDBi Q96BD0.
    TreeFami TF317540.

    Enzyme and pathway databases

    Reactomei REACT_23988. Transport of organic anions.

    Miscellaneous databases

    ChiTaRSi SLCO4A1. human.
    GeneWikii SLCO4A1.
    GenomeRNAii 28231.
    NextBioi 50544.
    PROi Q96BD0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q96BD0.
    Bgeei Q96BD0.
    CleanExi HS_SLCO4A1.
    Genevestigatori Q96BD0.

    Family and domain databases

    InterProi IPR002350. Kazal_dom.
    IPR020846. MFS_dom.
    IPR016196. MFS_dom_general_subst_transpt.
    IPR004156. OA_transporter.
    [Graphical view ]
    PANTHERi PTHR11388. PTHR11388. 1 hit.
    Pfami PF07648. Kazal_2. 1 hit.
    PF03137. OATP. 1 hit.
    [Graphical view ]
    SMARTi SM00280. KAZAL. 1 hit.
    [Graphical view ]
    SUPFAMi SSF103473. SSF103473. 3 hits.
    TIGRFAMsi TIGR00805. oat. 1 hit.
    PROSITEi PS51465. KAZAL_2. 1 hit.
    PS50850. MFS. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family."
      Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A.
      Biochem. Biophys. Res. Commun. 273:251-260(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Kidney.
    2. "Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner."
      Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M., Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K., Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S., Matsuno S., Abe T.
      Endocrinology 142:2005-2012(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Hippocampus.
    3. "Molecular cloning of a putative organic anion transporter, POAT."
      Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L.
      Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3).
    4. "Identification and characterization of novel human OATP family members."
      Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G.
      Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
    5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ILE-78.
      Tissue: Ovarian carcinoma.
    6. "The DNA sequence and comparative analysis of human chromosome 20."
      Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
      , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
      Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pancreas.
    8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiSO4A1_HUMAN
    AccessioniPrimary (citable) accession number: Q96BD0
    Secondary accession number(s): Q9H4T7
    , Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 10, 2003
    Last sequence update: January 10, 2003
    Last modified: October 1, 2014
    This is version 125 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 20
      Human chromosome 20: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3