Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Solute carrier organic anion transporter family member 4A1

Gene

SLCO4A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

GO - Molecular functioni

  1. transporter activity Source: InterPro

GO - Biological processi

  1. sodium-independent organic anion transport Source: Reactome
  2. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport

Enzyme and pathway databases

ReactomeiREACT_23988. Transport of organic anions.

Protein family/group databases

MEROPSiI01.972.
TCDBi2.A.60.1.9. the organo anion transporter (oat) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Solute carrier organic anion transporter family member 4A1
Short name:
OATP4A1
Alternative name(s):
Colon organic anion transporter
Organic anion transporter polypeptide-related protein 1
Short name:
OATP-RP1
Short name:
OATPRP1
Short name:
POAT
Organic anion-transporting polypeptide E
Short name:
OATP-E
Sodium-independent organic anion transporter E
Solute carrier family 21 member 12
Gene namesi
Name:SLCO4A1
Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 20

Organism-specific databases

HGNCiHGNC:10953. SLCO4A1.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 103103CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei104 – 12421Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini125 – 14319ExtracellularSequence AnalysisAdd
BLAST
Transmembranei144 – 16421Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini165 – 1706CytoplasmicSequence Analysis
Transmembranei171 – 19525Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini196 – 22227ExtracellularSequence AnalysisAdd
BLAST
Transmembranei223 – 25331Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini254 – 27219CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei273 – 29321Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini294 – 30714ExtracellularSequence AnalysisAdd
BLAST
Transmembranei308 – 33225Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini333 – 37846CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei379 – 40022Helical; Name=7Sequence AnalysisAdd
BLAST
Topological domaini401 – 42020ExtracellularSequence AnalysisAdd
BLAST
Transmembranei421 – 44424Helical; Name=8Sequence AnalysisAdd
BLAST
Topological domaini445 – 4484CytoplasmicSequence Analysis
Transmembranei449 – 47123Helical; Name=9Sequence AnalysisAdd
BLAST
Topological domaini472 – 580109ExtracellularSequence AnalysisAdd
BLAST
Transmembranei581 – 60323Helical; Name=10Sequence AnalysisAdd
BLAST
Topological domaini604 – 6129CytoplasmicSequence Analysis
Transmembranei613 – 63826Helical; Name=11Sequence AnalysisAdd
BLAST
Topological domaini639 – 67133ExtracellularSequence AnalysisAdd
BLAST
Transmembranei672 – 68918Helical; Name=12Sequence AnalysisAdd
BLAST
Topological domaini690 – 72233CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35838.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 722722Solute carrier organic anion transporter family member 4A1PRO_0000191067Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei34 – 341Phosphoserine1 Publication
Modified residuei37 – 371Phosphothreonine1 Publication
Modified residuei40 – 401Phosphoserine2 Publications
Modified residuei43 – 431Phosphoserine2 Publications
Modified residuei46 – 461Phosphoserine2 Publications
Modified residuei50 – 501Phosphoserine2 Publications
Glycosylationi499 – 4991N-linked (GlcNAc...)Sequence Analysis
Disulfide bondi504 ↔ 530PROSITE-ProRule annotation
Disulfide bondi508 ↔ 519PROSITE-ProRule annotation
Disulfide bondi510 ↔ 534PROSITE-ProRule annotation
Glycosylationi557 – 5571N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

MaxQBiQ96BD0.
PaxDbiQ96BD0.
PRIDEiQ96BD0.

PTM databases

PhosphoSiteiQ96BD0.

Expressioni

Tissue specificityi

Ubiquitous, with the exception of spleen and leukocytes.

Gene expression databases

BgeeiQ96BD0.
CleanExiHS_SLCO4A1.
ExpressionAtlasiQ96BD0. baseline and differential.
GenevestigatoriQ96BD0.

Organism-specific databases

HPAiHPA030669.
HPA030670.

Interactioni

Protein-protein interaction databases

BioGridi118180. 1 interaction.
IntActiQ96BD0. 1 interaction.
STRINGi9606.ENSP00000217159.

Structurei

3D structure databases

ProteinModelPortaliQ96BD0.
SMRiQ96BD0. Positions 507-533.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini498 – 55558Kazal-likePROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 Kazal-like domain.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG320775.
GeneTreeiENSGT00760000119014.
HOVERGENiHBG100565.
InParanoidiQ96BD0.
KOiK14354.
OMAiFKLRCSG.
PhylomeDBiQ96BD0.
TreeFamiTF317540.

Family and domain databases

InterProiIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR004156. OA_transporter.
[Graphical view]
PANTHERiPTHR11388. PTHR11388. 1 hit.
PfamiPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
TIGRFAMsiTIGR00805. oat. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 1 (identifier: Q96BD0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS
60 70 80 90 100
PLDTSKQPLC QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN
110 120 130 140 150
TPKGILFFLC AAAFLQGMTV NGFINTVITS LERRYDLHSY QSGLIASSYD
160 170 180 190 200
IAACLCLTFV SYFGGSGHKP RWLGWGVLLM GTGSLVFALP HFTAGRYEVE
210 220 230 240 250
LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG ATPLYTLGVT
260 270 280 290 300
YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT
310 320 330 340 350
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH
360 370 380 390 400
QLKDSSRGEA SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT
410 420 430 440 450
GMSTFSPKFL ESQFSLSASE AATLFGYLVV PAGGGGTFLG GFFVNKLRLR
460 470 480 490 500
GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP MAGVTASYGG SLLPEGHLNL
510 520 530 540 550
TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET NVDGQKVYRD
560 570 580 590 600
CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT
610 620 630 640 650
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG
660 670 680 690 700
QQGSCLVYQN SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE
710 720
TCLPSQSSAP DSATDSQLQS SV
Length:722
Mass (Da):77,193
Last modified:January 9, 2003 - v2
Checksum:iDD8F0C10E4BCD255
GO
Isoform 2 (identifier: Q96BD0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
     686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST

Show »
Length:583
Mass (Da):62,325
Checksum:i67342B00D99DCB31
GO
Isoform 3 (identifier: Q96BD0-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
     662-722: Missing.

Show »
Length:661
Mass (Da):70,454
Checksum:i39E50AB1FC24B071
GO
Isoform 4 (identifier: Q96BD0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

Show »
Length:722
Mass (Da):77,084
Checksum:i8A5B9415E0B1CB63
GO

Sequence cautioni

The sequence BAA91247.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti246 – 2461T → M in BAB14566 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti70 – 701R → Q.
Corresponds to variant rs34419428 [ dbSNP | Ensembl ].
VAR_053678
Natural varianti78 – 781V → I.1 Publication
Corresponds to variant rs1047099 [ dbSNP | Ensembl ].
VAR_053679

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei250 – 410161TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2. 1 PublicationVSP_006152Add
BLAST
Alternative sequencei548 – 661114YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3. CuratedVSP_006153Add
BLAST
Alternative sequencei572 – 60332STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4. 1 PublicationVSP_006154Add
BLAST
Alternative sequencei662 – 72261Missing in isoform 3. CuratedVSP_006155Add
BLAST
Alternative sequencei686 – 72237CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2. 1 PublicationVSP_006156Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031051 mRNA. Translation: BAA89288.1.
AF187817 mRNA. Translation: AAG43447.1.
AF104334 mRNA. Translation: AAF15545.1.
AF205072 mRNA. Translation: AAG42204.1.
AK023410 mRNA. Translation: BAB14566.1.
AK000551 mRNA. Translation: BAA91247.1. Different initiation.
AL357033 Genomic DNA. Translation: CAC14920.1.
AL357033 Genomic DNA. Translation: CAC14921.1.
BC015727 mRNA. Translation: AAH15727.1.
CCDSiCCDS13501.1. [Q96BD0-1]
RefSeqiNP_057438.3. NM_016354.3. [Q96BD0-1]
UniGeneiHs.235782.

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
GeneIDi28231.
KEGGihsa:28231.
UCSCiuc002ydb.1. human. [Q96BD0-1]

Polymorphism databases

DMDMi27734555.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB031051 mRNA. Translation: BAA89288.1.
AF187817 mRNA. Translation: AAG43447.1.
AF104334 mRNA. Translation: AAF15545.1.
AF205072 mRNA. Translation: AAG42204.1.
AK023410 mRNA. Translation: BAB14566.1.
AK000551 mRNA. Translation: BAA91247.1. Different initiation.
AL357033 Genomic DNA. Translation: CAC14920.1.
AL357033 Genomic DNA. Translation: CAC14921.1.
BC015727 mRNA. Translation: AAH15727.1.
CCDSiCCDS13501.1. [Q96BD0-1]
RefSeqiNP_057438.3. NM_016354.3. [Q96BD0-1]
UniGeneiHs.235782.

3D structure databases

ProteinModelPortaliQ96BD0.
SMRiQ96BD0. Positions 507-533.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118180. 1 interaction.
IntActiQ96BD0. 1 interaction.
STRINGi9606.ENSP00000217159.

Chemistry

ChEMBLiCHEMBL2073679.
DrugBankiDB01053. Benzylpenicillin.
DB00286. Conjugated Estrogens.
DB00509. Dextrothyroxine.
DB00390. Digoxin.
DB00917. Dinoprostone.
DB00783. Estradiol.
DB00451. Levothyroxine.
DB00279. Liothyronine.
DB01583. Liotrix.
GuidetoPHARMACOLOGYi1226.

Protein family/group databases

MEROPSiI01.972.
TCDBi2.A.60.1.9. the organo anion transporter (oat) family.

PTM databases

PhosphoSiteiQ96BD0.

Polymorphism databases

DMDMi27734555.

Proteomic databases

MaxQBiQ96BD0.
PaxDbiQ96BD0.
PRIDEiQ96BD0.

Protocols and materials databases

DNASUi28231.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
GeneIDi28231.
KEGGihsa:28231.
UCSCiuc002ydb.1. human. [Q96BD0-1]

Organism-specific databases

CTDi28231.
GeneCardsiGC20P061273.
H-InvDBHIX0015985.
HIX0138058.
HGNCiHGNC:10953. SLCO4A1.
HPAiHPA030669.
HPA030670.
MIMi612436. gene.
neXtProtiNX_Q96BD0.
PharmGKBiPA35838.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG320775.
GeneTreeiENSGT00760000119014.
HOVERGENiHBG100565.
InParanoidiQ96BD0.
KOiK14354.
OMAiFKLRCSG.
PhylomeDBiQ96BD0.
TreeFamiTF317540.

Enzyme and pathway databases

ReactomeiREACT_23988. Transport of organic anions.

Miscellaneous databases

ChiTaRSiSLCO4A1. human.
GeneWikiiSLCO4A1.
GenomeRNAii28231.
NextBioi50544.
PROiQ96BD0.
SOURCEiSearch...

Gene expression databases

BgeeiQ96BD0.
CleanExiHS_SLCO4A1.
ExpressionAtlasiQ96BD0. baseline and differential.
GenevestigatoriQ96BD0.

Family and domain databases

InterProiIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR004156. OA_transporter.
[Graphical view]
PANTHERiPTHR11388. PTHR11388. 1 hit.
PfamiPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SMARTiSM00280. KAZAL. 1 hit.
[Graphical view]
SUPFAMiSSF103473. SSF103473. 3 hits.
TIGRFAMsiTIGR00805. oat. 1 hit.
PROSITEiPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family."
    Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A.
    Biochem. Biophys. Res. Commun. 273:251-260(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Kidney.
  2. "Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner."
    Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M., Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K., Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S., Matsuno S., Abe T.
    Endocrinology 142:2005-2012(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
    Tissue: Hippocampus.
  3. "Molecular cloning of a putative organic anion transporter, POAT."
    Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L.
    Submitted (OCT-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3).
  4. "Identification and characterization of novel human OATP family members."
    Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G.
    Submitted (OCT-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ILE-78.
    Tissue: Ovarian carcinoma.
  6. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Pancreas.
  8. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  10. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiSO4A1_HUMAN
AccessioniPrimary (citable) accession number: Q96BD0
Secondary accession number(s): Q9H4T7
, Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 9, 2003
Last sequence update: January 9, 2003
Last modified: January 6, 2015
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.