Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q96BD0 (SO4A1_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 123. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Solute carrier organic anion transporter family member 4A1

Short name=OATP4A1
Alternative name(s):
Colon organic anion transporter
Organic anion transporter polypeptide-related protein 1
Short name=OATP-RP1
Short name=OATPRP1
Short name=POAT
Organic anion-transporting polypeptide E
Short name=OATP-E
Sodium-independent organic anion transporter E
Solute carrier family 21 member 12
Gene names
Name:SLCO4A1
Synonyms:OATP1, OATP4A1, OATPE, SLC21A12
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length722 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Mediates the Na+-independent transport of organic anions such as the thyroid hormones T3 (triiodo-L-thyronine), T4 (thyroxine) and rT3, and of estrone-3-sulfate and taurocholate.

Subcellular location

Cell membrane; Multi-pass membrane protein.

Tissue specificity

Ubiquitous, with the exception of spleen and leukocytes.

Sequence similarities

Belongs to the organo anion transporter (TC 2.A.60) family. [View classification]

Contains 1 Kazal-like domain.

Sequence caution

The sequence BAA91247.1 differs from that shown. Reason: Erroneous initiation.

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 1 (identifier: Q96BD0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q96BD0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     250-410: TYLDENVKSS...GMSTFSPKFL → LFFAIACFLYKPLS
     686-722: CFLYKPLSES...ATDSQLQSSV → SSRAASDHRP...ELLFDLQPST
Isoform 3 (identifier: Q96BD0-3)

The sequence of this isoform differs from the canonical sequence as follows:
     548-661: YRDCSCIPQN...QGSCLVYQNS → SGAAAYRPCP...QHPEAELCRS
     662-722: Missing.
Isoform 4 (identifier: Q96BD0-4)

The sequence of this isoform differs from the canonical sequence as follows:
     572-603: STCQRKPLLLVFIFVVIFFTFLSSIPALTATL → TTALCAARTASCTSHCATQGALQPRRRMWTAR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 722722Solute carrier organic anion transporter family member 4A1
PRO_0000191067

Regions

Topological domain1 – 103103Cytoplasmic Potential
Transmembrane104 – 12421Helical; Name=1; Potential
Topological domain125 – 14319Extracellular Potential
Transmembrane144 – 16421Helical; Name=2; Potential
Topological domain165 – 1706Cytoplasmic Potential
Transmembrane171 – 19525Helical; Name=3; Potential
Topological domain196 – 22227Extracellular Potential
Transmembrane223 – 25331Helical; Name=4; Potential
Topological domain254 – 27219Cytoplasmic Potential
Transmembrane273 – 29321Helical; Name=5; Potential
Topological domain294 – 30714Extracellular Potential
Transmembrane308 – 33225Helical; Name=6; Potential
Topological domain333 – 37846Cytoplasmic Potential
Transmembrane379 – 40022Helical; Name=7; Potential
Topological domain401 – 42020Extracellular Potential
Transmembrane421 – 44424Helical; Name=8; Potential
Topological domain445 – 4484Cytoplasmic Potential
Transmembrane449 – 47123Helical; Name=9; Potential
Topological domain472 – 580109Extracellular Potential
Transmembrane581 – 60323Helical; Name=10; Potential
Topological domain604 – 6129Cytoplasmic Potential
Transmembrane613 – 63826Helical; Name=11; Potential
Topological domain639 – 67133Extracellular Potential
Transmembrane672 – 68918Helical; Name=12; Potential
Topological domain690 – 72233Cytoplasmic Potential
Domain498 – 55558Kazal-like

Amino acid modifications

Modified residue341Phosphoserine Ref.9
Modified residue371Phosphothreonine Ref.9
Modified residue401Phosphoserine Ref.9 Ref.10
Modified residue431Phosphoserine Ref.9 Ref.10
Modified residue461Phosphoserine Ref.9 Ref.10
Modified residue501Phosphoserine Ref.9 Ref.10
Glycosylation4991N-linked (GlcNAc...) Potential
Glycosylation5571N-linked (GlcNAc...) Potential
Disulfide bond504 ↔ 530 By similarity
Disulfide bond508 ↔ 519 By similarity
Disulfide bond510 ↔ 534 By similarity

Natural variations

Alternative sequence250 – 410161TYLDE…SPKFL → LFFAIACFLYKPLS in isoform 2.
VSP_006152
Alternative sequence548 – 661114YRDCS…VYQNS → SGAAAYRPCPPLDPGKGPPC LPLVIGAIVGLPRCTETVAV SLRIFPLVLAMHCREMHFNL SEKAPPSGFHIRCNFLYIPQ QHSCTNGNSTVSWGRVCACP ELSLQHPEAELCRS in isoform 3.
VSP_006153
Alternative sequence572 – 60332STCQR…LTATL → TTALCAARTASCTSHCATQG ALQPRRRMWTAR in isoform 4.
VSP_006154
Alternative sequence662 – 72261Missing in isoform 3.
VSP_006155
Alternative sequence686 – 72237CFLYK…LQSSV → SSRAASDHRPRPPGHGGHSA FPDDRTVPLGDAITRELLFD LQPST in isoform 2.
VSP_006156
Natural variant701R → Q.
Corresponds to variant rs34419428 [ dbSNP | Ensembl ].
VAR_053678
Natural variant781V → I. Ref.5
Corresponds to variant rs1047099 [ dbSNP | Ensembl ].
VAR_053679

Experimental info

Sequence conflict2461T → M in BAB14566. Ref.5

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified January 10, 2003. Version 2.
Checksum: DD8F0C10E4BCD255

FASTA72277,193
        10         20         30         40         50         60 
MPLHQLGDKP LTFPSPNSAM ENGLDHTPPS RRASPGTPLS PGSLRSAAHS PLDTSKQPLC 

        70         80         90        100        110        120 
QLWAEKHGAR GTHEVRYVSA GQSVACGWWA FAPPCLQVLN TPKGILFFLC AAAFLQGMTV 

       130        140        150        160        170        180 
NGFINTVITS LERRYDLHSY QSGLIASSYD IAACLCLTFV SYFGGSGHKP RWLGWGVLLM 

       190        200        210        220        230        240 
GTGSLVFALP HFTAGRYEVE LDAGVRTCPA NPGAVCADST SGLSRYQLVF MLGQFLHGVG 

       250        260        270        280        290        300 
ATPLYTLGVT YLDENVKSSC SPVYIAIFYT AAILGPAAGY LIGGALLNIY TEMGRRTELT 

       310        320        330        340        350        360 
TESPLWVGAW WVGFLGSGAA AFFTAVPILG YPRQLPGSQR YAVMRAAEMH QLKDSSRGEA 

       370        380        390        400        410        420 
SNPDFGKTIR DLPLSIWLLL KNPTFILLCL AGATEATLIT GMSTFSPKFL ESQFSLSASE 

       430        440        450        460        470        480 
AATLFGYLVV PAGGGGTFLG GFFVNKLRLR GSAVIKFCLF CTVVSLLGIL VFSLHCPSVP 

       490        500        510        520        530        540 
MAGVTASYGG SLLPEGHLNL TAPCNAACSC QPEHYSPVCG SDGLMYFSLC HAGCPAATET 

       550        560        570        580        590        600 
NVDGQKVYRD CSCIPQNLSS GFGHATAGKC TSTCQRKPLL LVFIFVVIFF TFLSSIPALT 

       610        620        630        640        650        660 
ATLRCVRDPQ RSFALGIQWI VVRILGGIPG PIAFGWVIDK ACLLWQDQCG QQGSCLVYQN 

       670        680        690        700        710        720 
SAMSRYILIM GLLYKVLGVL FFAIACFLYK PLSESSDGLE TCLPSQSSAP DSATDSQLQS 


SV 

« Hide

Isoform 2 [UniParc].

Checksum: 67342B00D99DCB31
Show »

FASTA58362,325
Isoform 3 [UniParc].

Checksum: 39E50AB1FC24B071
Show »

FASTA66170,454
Isoform 4 [UniParc].

Checksum: 8A5B9415E0B1CB63
Show »

FASTA72277,084

References

« Hide 'large scale' references
[1]"Molecular identification and characterization of novel members of the human organic anion transporter (OATP) family."
Tamai I., Nezu J., Uchino H., Sai Y., Oku A., Shimane M., Tsuji A.
Biochem. Biophys. Res. Commun. 273:251-260(2000) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Kidney.
[2]"Identification of thyroid hormone transporters in humans: different molecules are involved in a tissue-specific manner."
Fujiwara K., Adachi H., Nishio T., Unno M., Tokui T., Okabe M., Onogawa T., Suzuki T., Asano N., Tanemoto M., Seki M., Shiiba K., Suzuki M., Kondo Y., Nunoki K., Shimosegawa T., Iinuma K., Ito S., Matsuno S., Abe T.
Endocrinology 142:2005-2012(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
Tissue: Hippocampus.
[3]"Molecular cloning of a putative organic anion transporter, POAT."
Itoh S., Coca-Prados M., Lu R., Chan B.S., Schuster V.L.
Submitted (NOV-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 3).
[4]"Identification and characterization of novel human OATP family members."
Wu Y., Hsiang B.H., Zhu Y., Yang W.-P., Kirchgessner T.G.
Submitted (NOV-1999) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE (ISOFORM 1).
[5]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 4), VARIANT ILE-78.
Tissue: Ovarian carcinoma.
[6]"The DNA sequence and comparative analysis of human chromosome 20."
Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. expand/collapse author list , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Pancreas.
[8]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[9]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-34; THR-37; SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[10]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-40; SER-43; SER-46 AND SER-50, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB031051 mRNA. Translation: BAA89288.1.
AF187817 mRNA. Translation: AAG43447.1.
AF104334 mRNA. Translation: AAF15545.1.
AF205072 mRNA. Translation: AAG42204.1.
AK023410 mRNA. Translation: BAB14566.1.
AK000551 mRNA. Translation: BAA91247.1. Different initiation.
AL357033 Genomic DNA. Translation: CAC14920.1.
AL357033 Genomic DNA. Translation: CAC14921.1.
BC015727 mRNA. Translation: AAH15727.1.
CCDSCCDS13501.1. [Q96BD0-1]
RefSeqNP_057438.3. NM_016354.3. [Q96BD0-1]
UniGeneHs.235782.

3D structure databases

ProteinModelPortalQ96BD0.
SMRQ96BD0. Positions 507-537, 601-641.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid118180. 1 interaction.
IntActQ96BD0. 1 interaction.
STRING9606.ENSP00000217159.

Chemistry

ChEMBLCHEMBL2073679.
GuidetoPHARMACOLOGY1226.

Protein family/group databases

TCDB2.A.60.1.9. the organo anion transporter (oat) family.

PTM databases

PhosphoSiteQ96BD0.

Polymorphism databases

DMDM27734555.

Proteomic databases

MaxQBQ96BD0.
PaxDbQ96BD0.
PRIDEQ96BD0.

Protocols and materials databases

DNASU28231.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000217159; ENSP00000217159; ENSG00000101187. [Q96BD0-1]
ENST00000370507; ENSP00000359538; ENSG00000101187. [Q96BD0-1]
GeneID28231.
KEGGhsa:28231.
UCSCuc002ydb.1. human. [Q96BD0-1]

Organism-specific databases

CTD28231.
GeneCardsGC20P061273.
H-InvDBHIX0015985.
HIX0138058.
HGNCHGNC:10953. SLCO4A1.
HPAHPA030669.
HPA030670.
MIM612436. gene.
neXtProtNX_Q96BD0.
PharmGKBPA35838.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG320775.
HOVERGENHBG100565.
InParanoidQ96BD0.
KOK14354.
OMAFKLRCSG.
PhylomeDBQ96BD0.
TreeFamTF317540.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ96BD0.
BgeeQ96BD0.
CleanExHS_SLCO4A1.
GenevestigatorQ96BD0.

Family and domain databases

InterProIPR002350. Kazal_dom.
IPR020846. MFS_dom.
IPR016196. MFS_dom_general_subst_transpt.
IPR004156. OA_transporter.
[Graphical view]
PANTHERPTHR11388. PTHR11388. 1 hit.
PfamPF07648. Kazal_2. 1 hit.
PF03137. OATP. 1 hit.
[Graphical view]
SMARTSM00280. KAZAL. 1 hit.
[Graphical view]
SUPFAMSSF103473. SSF103473. 3 hits.
TIGRFAMsTIGR00805. oat. 1 hit.
PROSITEPS51465. KAZAL_2. 1 hit.
PS50850. MFS. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSSLCO4A1. human.
GeneWikiSLCO4A1.
GenomeRNAi28231.
NextBio50544.
PROQ96BD0.
SOURCESearch...

Entry information

Entry nameSO4A1_HUMAN
AccessionPrimary (citable) accession number: Q96BD0
Secondary accession number(s): Q9H4T7 expand/collapse secondary AC list , Q9H4T8, Q9H8P2, Q9NWX8, Q9UI35, Q9UIG7
Entry history
Integrated into UniProtKB/Swiss-Prot: January 10, 2003
Last sequence update: January 10, 2003
Last modified: July 9, 2014
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 20

Human chromosome 20: entries, gene names and cross-references to MIM