Q96B97 (SH3K1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 119.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: SH3 domain-containing kinase-binding protein 1 Alternative name(s): CD2-binding protein 3 Short name=CD2BP3 Cbl-interacting protein of 85 kDa Human Src family kinase-binding protein 1 Short name=HSB-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 665 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit By similarity. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration. Ref.8 Ref.9 Ref.10 Ref.13 Ref.15 Ref.17 Ref.19 Ref.21 Ref.22 Ref.31 |
| Subunit structure | Can self-associate and form homotetramers. Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, MAGI2, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with CBL and CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP. Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer. Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2. Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL. Interacts with DDN and probably associates with MAGI2 through its interaction with DDN. Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK. Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Probably interacts with SH3KBP1. Ref.1 Ref.7 Ref.8 Ref.9 Ref.10 Ref.12 Ref.13 Ref.14 Ref.17 Ref.18 Ref.19 Ref.20 Ref.21 Ref.23 Ref.25 Ref.26 |
| Subcellular location | Cytoplasm › cytoskeleton. Cytoplasmic vesicle membrane; Peripheral membrane protein. Cell junction › synapse › synaptosome. Cell junction › focal adhesion By similarity. Note: Localized in endocytic vesicles containing clustered receptors. Colocalizes with ASAP1 in vesicular structures. Colocalized with actin microfilaments and focal adhesions By similarity. Colocalized with MAGI2 in synaptosomes By similarity. Ref.8 Ref.9 Ref.17 Ref.25 |
| Tissue specificity | Ubiquitously expressed. Also expressed in some cancer cell lines. |
| Domain | The SH3 domains mediate interaction with SHKBP1 By similarity. |
| Post-translational modification | Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus. |
| Sequence similarities | Contains 3 SH3 domains. |
| Sequence caution | The sequence AAH50663.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| CBL | P22681 | 6 | EBI-346595,EBI-518228 | |
| Dab2 | P98078 | 9 | EBI-346595,EBI-1391846 | From a different organism. |
| DDN | O94850 | 5 | EBI-346595,EBI-5240523 |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q96B97-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: Interacts with CBL. | ||||||
| Isoform 2 (identifier: Q96B97-2) The sequence of this isoform differs from the canonical sequence as follows: 1-54: MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVR → MEVSAAKAPSAADLSEI | ||||||
| Note: Interacts with CD2 cytoplasmic tail and does not interact with F-actin. | ||||||
| Isoform 3 (identifier: Q96B97-3) The sequence of this isoform differs from the canonical sequence as follows: 1-4: MVEA → MGEE 5-242: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 665 | 665 | SH3 domain-containing kinase-binding protein 1 | PRO_0000097728 | ||||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||||
| Domain | 1 – 58 | 58 | SH3 1 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 98 – 157 | 60 | SH3 2 | |||||||||||||||||||||||||||||||||||||||||||
| Domain | 267 – 328 | 62 | SH3 3 | |||||||||||||||||||||||||||||||||||||||||||
| Coiled coil | 602 – 664 | 63 | Potential | |||||||||||||||||||||||||||||||||||||||||||
| Compositional bias | 327 – 428 | 102 | Pro-rich | |||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 156 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 230 | 1 | Phosphoserine Ref.16 Ref.24 Ref.27 Ref.29 Ref.30 Ref.33 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 254 | 1 | Phosphothreonine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 436 | 1 | Phosphoserine Ref.28 Ref.30 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 468 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 509 | 1 | Phosphoserine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 511 | 1 | Phosphoserine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 521 | 1 | Phosphoserine Ref.28 | |||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 587 | 1 | Phosphoserine Ref.28 Ref.30 | |||||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 54 | 54 | MVEAI…DNFVR → MEVSAAKAPSAADLSEI in isoform 2. | VSP_007504 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 – 4 | 4 | MVEA → MGEE in isoform 3. | VSP_044655 | ||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 5 – 242 | 238 | Missing in isoform 3. | VSP_044656 | ||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 382 | 1 | P → L. Ref.6 | VAR_015667 | ||||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 288 | 1 | I → T in BAH11471. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 426 | 1 | V → A in BAH11471. Ref.3 | |||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 570 | 1 | A → V in AAH15806. Ref.5 | |||||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 4 – 8 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 25 – 30 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 33 – 35 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 36 – 41 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 44 – 49 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 50 – 52 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 53 – 55 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 102 – 105 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 113 – 115 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 124 – 126 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 130 – 132 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 149 – 153 | 5 | ||||||||||||||||||||||||||||||||||||||||||||
| Turn | 161 – 164 | 4 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 270 – 276 | 7 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 283 – 285 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 293 – 299 | 7 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 301 – 303 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 306 – 311 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 314 – 319 | 6 | ||||||||||||||||||||||||||||||||||||||||||||
| Helix | 320 – 322 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 323 – 325 | 3 | ||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning and characterization of a novel adaptor protein, CIN85, that interacts with c-Cbl." Take H., Watanabe S., Takeda K., Yu Z.-X., Iwata N., Kajigaya S. Biochem. Biophys. Res. Commun. 268:321-328(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH CBL. |
| [2] | "CD2BP3, CIN85 and the structurally related adaptor protein CMS bind to the same CD2 cytoplasmic segment but elicit divergent functional activities." Tibaldi E.V., Reinherz E.L. Int. Immunol. 15:313-329(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2). Tissue: T-cell. |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3). |
| [4] | "The DNA sequence of the human X chromosome." Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C. Bentley D.R.Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Adrenal cortex and Uterus. |
| [6] | "Assignment of SH3KBP1 to human chromosome band Xp22.1-->p21.3 by in situ hybridization." Narita T., Amano F., Yoshizaki K., Nishimoto N., Nishimura T., Tajima T., Namiki H., Taniyama T. Cytogenet. Cell Genet. 93:133-134(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-665, VARIANT LEU-382. |
| [7] | "Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes." Watanabe S., Take H., Takeda K., Yu Z.X., Iwata N., Kajigaya S. Biochem. Biophys. Res. Commun. 278:167-174(2000) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BLNK; CRK; BCAR1; PIK3R3; GRB2 AND SOS1, SELF-ASSOCIATION. |
| [8] | "CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases." Szymkiewicz I., Kowanetz K., Soubeyran P., Dinarina A., Lipkowitz S., Dikic I. J. Biol. Chem. 277:39666-39672(2002) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CBLB AND ENDOPHILINS, LACK OF INTERACTION WITH CBLC, FUNCTION IN RECEPTOR INTERNALIZATION, SUBCELLULAR LOCATION. |
| [9] | "Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors." Soubeyran P., Kowanetz K., Szymkiewicz I., Langdon W.Y., Dikic I. Nature 416:183-187(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH EGFR; SH3GL1; SH3GL2; SH3GL3 AND CBL, SUBCELLULAR LOCATION. |
| [10] | "The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met." Petrelli A., Gilestro G.F., Lanzardo S., Comoglio P.M., Migone N., Giordano S. Nature 416:187-190(2002) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH SH3GL1; SH3GL2; SH3GL3; CBL AND MET. |
| [11] | "Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors." Haglund K., Shimokawa N., Szymkiewicz I., Dikic I. Proc. Natl. Acad. Sci. U.S.A. 99:12191-12196(2002) [PubMed] [Europe PMC] [Abstract] Cited for: UBIQUITINATION BY CBL AND CBLB. |
| [12] | "Dab2 links CIN85 with clathrin-mediated receptor internalization." Kowanetz K., Terzic J., Dikic I. FEBS Lett. 554:81-87(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DAB2, IDENTIFICATION IN A COMPLEX WITH DAB2 AND CLATHRIN. |
| [13] | "SETA/CIN85/Ruk and its binding partner AIP1 associate with diverse cytoskeletal elements, including FAKs, and modulate cell adhesion." Schmidt M.H., Chen B., Randazzo L.M., Boegler O. J. Cell Sci. 116:2845-2855(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN CELL ADHESION, INTERACTION WITH PDCD6IP; PTK2/FAK1 AND PTK2B/PYK2. |
| [14] | "Linking the T cell surface protein CD2 to the actin-capping protein CAPZ via CMS and CIN85." Hutchings N.J., Clarkson N., Chalkley R., Barclay A.N., Brown M.H. J. Biol. Chem. 278:22396-22403(2003) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH CD2 AND F-ACTIN CAPPING PROTEIN. |
| [15] | "Epidermal growth factor receptor signaling intensity determines intracellular protein interactions, ubiquitination, and internalization." Schmidt M.H., Furnari F.B., Cavenee W.K., Bogler O. Proc. Natl. Acad. Sci. U.S.A. 100:6505-6510(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN RECEPTOR INTERNALIZATION. |
| [16] | "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry." Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C. Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [17] | "CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors." Kowanetz K., Husnjak K., Holler D., Kowanetz M., Soubeyran P., Hirsch D., Schmidt M.H., Pavelic K., De Camilli P., Randazzo P.A., Dikic I. Mol. Biol. Cell 15:3155-3166(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH ASAP1; ARAP3; HIP1R; SYNJ2; INPP5D; STAP1 AND EGFR, IDENTIFICATION IN A COMPLEX WITH ASAP1 AND ARAP3, SUBCELLULAR LOCATION. |
| [18] | "Alix/AIP1 antagonizes epidermal growth factor receptor downregulation by the Cbl-SETA/CIN85 complex." Schmidt M.H., Hoeller D., Yu J., Furnari F.B., Cavenee W.K., Dikic I., Bogler O. Mol. Cell. Biol. 24:8981-8993(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH PDCD6IP; EGFR; CBL AND CBLB. |
| [19] | "CIN85 regulates the ability of MEKK4 to activate the p38 MAP kinase pathway." Aissouni Y., Zapart G., Iovanna J.L., Dikic I., Soubeyran P. Biochem. Biophys. Res. Commun. 338:808-814(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH MAP3K4. |
| [20] | "Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation." Haglund K., Schmidt M.H., Wong E.S., Guy G.R., Dikic I. EMBO Rep. 6:635-641(2005) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH SPRY2. |
| [21] | "CIN85 associates with TNF receptor 1 via Src and modulates TNF-alpha-induced apoptosis." Narita T., Nishimura T., Yoshizaki K., Taniyama T. Exp. Cell Res. 304:256-264(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN APOPTOSIS, INTERACTION WITH SRC; LCK; LYN; FGR; FYN; HCK; TRADD; BIRC2; TRAF1; TRAF2 AND TNFR1. |
| [22] | "CIN85 regulates the ligand-dependent endocytosis of the IgE receptor: a new molecular mechanism to dampen mast cell function." Molfetta R., Belleudi F., Peruzzi G., Morrone S., Leone L., Dikic I., Piccoli M., Frati L., Torrisi M.R., Santoni A., Paolini R. J. Immunol. 175:4208-4216(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION IN RECEPTOR INTERNALIZATION. |
| [23] | "A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells." Wells C.D., Fawcett J.P., Traweger A., Yamanaka Y., Goudreault M., Elder K., Kulkarni S., Gish G., Virag C., Lim C., Colwill K., Starostine A., Metalnikov P., Pawson T. Cell 125:535-548(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH ARHGAP17. |
| [24] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [25] | "CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin." Kawata A., Iida J., Ikeda M., Sato Y., Mori H., Kansaku A., Sumita K., Fujiwara N., Rokukawa C., Hamano M., Hirabayashi S., Hata Y. J. Biochem. 139:931-939(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH DDN AND MAGI2, SUBCELLULAR LOCATION. |
| [26] | "CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP." Konishi H., Tashiro K., Murata Y., Nabeshi H., Yamauchi E., Taniguchi H. J. Biol. Chem. 281:28919-28931(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH MVB12A. |
| [27] | "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment." Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J. J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, MASS SPECTROMETRY. Tissue: T-cell. |
| [28] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-254; SER-436; SER-509; SER-511; SER-521 AND SER-587, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [29] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, MASS SPECTROMETRY. Tissue: Leukemic T-cell. |
| [30] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230; SER-436 AND SER-587, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [31] | "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration." Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J. BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [32] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [33] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, MASS SPECTROMETRY. |
| [34] | "Cbl promotes clustering of endocytic adaptor proteins." Jozic D., Cardenes N., Deribe Y.L., Moncalian G., Hoeller D., Groemping Y., Dikic I., Rittinger K., Bravo J. Nat. Struct. Mol. Biol. 12:972-979(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-58 IN COMPLEX WITH CBLB. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF230904 mRNA. Translation: AAF37854.1. AF542051 mRNA. Translation: AAN77231.1. AK293234 mRNA. Translation: BAH11470.1. AK293237 mRNA. Translation: BAH11471.1. AL732423, AL732325, AL732327 Genomic DNA. Translation: CAI40277.1. AL732423, AL732327 Genomic DNA. Translation: CAI40278.1. AL732327, AL732325, AL732423 Genomic DNA. Translation: CAI40511.1. AL732327, AL732423 Genomic DNA. Translation: CAI40512.1. AL732325, AL732327, AL732423 Genomic DNA. Translation: CAI41254.1. AL732409 Genomic DNA. No translation available. AL772197 Genomic DNA. No translation available. BC015806 mRNA. Translation: AAH15806.1. BC050663 mRNA. Translation: AAH50663.1. Sequence problems. AF329267 mRNA. Translation: AAK95587.1. AF329268 mRNA. Translation: AAO13348.1. | ||||||||||||||||||||||||||||||||||||
| IPI | IPI00294962. IPI00477897. IPI00643458. | ||||||||||||||||||||||||||||||||||||
| PIR | JC7191. | ||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001019837.1. NM_001024666.2. NP_001171889.1. NM_001184960.1. NP_114098.1. NM_031892.2. | ||||||||||||||||||||||||||||||||||||
| UniGene | Hs.726365. | ||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q96B97. | ||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||
| IntAct | Q96B97. 16 interactions. | ||||||||||||||||||||||||||||||||||||
| MINT | MINT-233697. | ||||||||||||||||||||||||||||||||||||
| STRING | 9606.ENSP00000380921. | ||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q96B97. | ||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||
| DMDM | 31077034. | ||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||
| PaxDb | Q96B97. | ||||||||||||||||||||||||||||||||||||
| PRIDE | Q96B97. | ||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||
| DNASU | 30011. | ||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000379698; ENSP00000369020; ENSG00000147010. ENST00000379716; ENSP00000369039; ENSG00000147010. ENST00000397821; ENSP00000380921; ENSG00000147010. | ||||||||||||||||||||||||||||||||||||
| GeneID | 30011. | ||||||||||||||||||||||||||||||||||||
| KEGG | hsa:30011. | ||||||||||||||||||||||||||||||||||||
| UCSC | uc004czm.3. human. | ||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||
| CTD | 30011. | ||||||||||||||||||||||||||||||||||||
| GeneCards | GC0XM019552. | ||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:13867. SH3KBP1. | ||||||||||||||||||||||||||||||||||||
| HPA | CAB021892. HPA003351. HPA003355. | ||||||||||||||||||||||||||||||||||||
| MIM | 300374. gene. | ||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q96B97. | ||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37822. | ||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||
| eggNOG | NOG319250. | ||||||||||||||||||||||||||||||||||||
| HOGENOM | HOG000231405. | ||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG057824. | ||||||||||||||||||||||||||||||||||||
| InParanoid | Q96B97. | ||||||||||||||||||||||||||||||||||||
| KO | K12470. | ||||||||||||||||||||||||||||||||||||
| OMA | KAPEKPM. | ||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG4FN4HD. | ||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q96B97. | ||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | met_pathway. Signaling events activated by Hepatocyte Growth Factor Receptor (c-Met). | ||||||||||||||||||||||||||||||||||||
| Reactome | REACT_111102. Signal Transduction. REACT_116125. Disease. REACT_6900. Immune System. | ||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q96B97. | ||||||||||||||||||||||||||||||||||||
| Bgee | Q96B97. | ||||||||||||||||||||||||||||||||||||
| CleanEx | HS_SH3KBP1. | ||||||||||||||||||||||||||||||||||||
| Genevestigator | Q96B97. | ||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000147010. Homo sapiens. | ||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||
| InterPro | IPR000108. p67phox. IPR011511. SH3_2. IPR001452. SH3_domain. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| Pfam | PF00018. SH3_1. 1 hit. PF07653. SH3_2. 2 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| PRINTS | PR00499. P67PHOX. PR00452. SH3DOMAIN. | ||||||||||||||||||||||||||||||||||||
| SMART | SM00326. SH3. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50044. SH3. 3 hits. | ||||||||||||||||||||||||||||||||||||
| PROSITE | PS50002. SH3. 3 hits. [Graphical view] | ||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||
| ChiTaRS | SH3KBP1. human. | ||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q96B97. | ||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 30011. | ||||||||||||||||||||||||||||||||||||
| NextBio | 52832. | ||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SH3K1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q96B97 Secondary accession number(s): B7Z1D5 Q9NYR0 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
