SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q96B97

- SH3K1_HUMAN

UniProt

Q96B97 - SH3K1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
SH3 domain-containing kinase-binding protein 1
Gene
SH3KBP1, CIN85
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit By similarity. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration.10 Publications

GO - Molecular functioni

  1. protein binding Source: IntAct
Complete GO annotation...

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cell migration Source: UniProtKB
  3. cell-cell signaling Source: UniProtKB
  4. cytoskeleton organization Source: UniProtKB
  5. endocytosis Source: UniProtKB-KW
  6. epidermal growth factor receptor signaling pathway Source: Reactome
  7. negative regulation of epidermal growth factor receptor signaling pathway Source: Reactome
  8. regulation of cell shape Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis, Endocytosis

Enzyme and pathway databases

ReactomeiREACT_118700. Antigen activates B Cell Receptor (BCR) leading to generation of second messengers.
REACT_12484. EGFR downregulation.
SignaLinkiQ96B97.

Names & Taxonomyi

Protein namesi
Recommended name:
SH3 domain-containing kinase-binding protein 1
Alternative name(s):
CD2-binding protein 3
Short name:
CD2BP3
Cbl-interacting protein of 85 kDa
Human Src family kinase-binding protein 1
Short name:
HSB-1
Gene namesi
Name:SH3KBP1
Synonyms:CIN85
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:13867. SH3KBP1.

Subcellular locationi

Cytoplasmcytoskeleton. Cytoplasmic vesicle membrane; Peripheral membrane protein. Cell junctionsynapsesynaptosome. Cell junctionfocal adhesion By similarity
Note: Localized in endocytic vesicles containing clustered receptors. Colocalizes with ASAP1 in vesicular structures. Colocalized with actin microfilaments and focal adhesions By similarity. Colocalized with MAGI2 in synaptosomes By similarity.4 Publications

GO - Cellular componenti

  1. cytoplasmic vesicle membrane Source: UniProtKB-SubCell
  2. cytoskeleton Source: UniProtKB-SubCell
  3. cytosol Source: Reactome
  4. focal adhesion Source: UniProtKB-SubCell
  5. neuron projection Source: UniProtKB-SubCell
  6. plasma membrane Source: Reactome
  7. synapse Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cytoplasm, Cytoplasmic vesicle, Cytoskeleton, Membrane, Synapse, Synaptosome

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA37822.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 665665SH3 domain-containing kinase-binding protein 1
PRO_0000097728Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei230 – 2301Phosphoserine6 Publications
Modified residuei254 – 2541Phosphothreonine1 Publication
Modified residuei436 – 4361Phosphoserine2 Publications
Modified residuei509 – 5091Phosphoserine1 Publication
Modified residuei511 – 5111Phosphoserine1 Publication
Modified residuei521 – 5211Phosphoserine1 Publication
Modified residuei587 – 5871Phosphoserine2 Publications

Post-translational modificationi

Monoubiquitinated by CBL and CBLB after EGF stimulation; probably on its C-terminus.

Keywords - PTMi

Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ96B97.
PaxDbiQ96B97.
PRIDEiQ96B97.

PTM databases

PhosphoSiteiQ96B97.

Expressioni

Tissue specificityi

Ubiquitously expressed. Also expressed in some cancer cell lines.

Gene expression databases

ArrayExpressiQ96B97.
BgeeiQ96B97.
CleanExiHS_SH3KBP1.
GenevestigatoriQ96B97.

Organism-specific databases

HPAiCAB021892.
HPA003351.
HPA003355.

Interactioni

Subunit structurei

Can self-associate and form homotetramers. Interacts with CD2, F-actin capping protein, PIK3R3, GRB2, EGFR, MET, BLNK, MAP3K4, PDCD6IP, SPRY2, ARHGAP17, ARHGAP27, MAGI2, CRK, BCAR1, SOS1, ASAP1, ARAP3, HIP1R, SYNJ2, INPP5D and STAP1. Interacts with CBL and CBLB, but does not interact with CBLC. Two molecules of SH3KBP1 seem to bind through their respective SH3 1 domain to one molecule of CBLB. The interaction with CBL or CBLB and EGFR is increased upon EGF stimulation. The interaction with CBL is attenuated by PDCD6IP. Interacts through its proline-rich region with the SH3 domain of endophilins SH3GL1, SH3GL2 and SH3GL3. The SH3KBP1-endophilin complex seems to associate with a complex containing the phosphorylated receptor (EGFR or MET) and phosphorylated CBL. Probably associates with ASAP1 and phosphorylated EGFR. Probably part of a complex consisting of at least SH3KBP1, ASAP1 and ARAP3. Interacts with focal adhesion kinases PTK2/FAK1 AND PTK2B/PYK2, probably as a dimer. Interacts with DAB2 and probably associates with chathrin through its interaction with DAB2. Part of a complex consisting of SH3KBP1, DAB2, and clathrin heavy chain. DAB2 and clathrin dissociate from SH3KBP1 following growth factor treatment, enabling interaction with CBL. Interacts with DDN and probably associates with MAGI2 through its interaction with DDN. Interacts with the SH3 domains of SRC tyrosine-protein kinases SRC, LCK, LYN, FGR, FYN and HCK. Interacts with TRADD, BIRC2, TRAF1, TRAF2 and TNFR1, and the association with a TNFR1-associated complex upon stimulation with TNF-alpha seems to be mediated by SRC. Probably interacts with SH3KBP1.16 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ARAP3Q8WWN82EBI-346595,EBI-4402732
ASAP1Q9ULH18EBI-346595,EBI-346622
CAPZA1P529072EBI-346595,EBI-355586
CBLP2268117EBI-346595,EBI-518228
CBLBQ1319119EBI-346595,EBI-744027
CD2P067293EBI-346595,EBI-3912464
Dab2P980789EBI-346595,EBI-1391846From a different organism.
DDNO948505EBI-346595,EBI-5240523
DNM2P505705EBI-346595,EBI-346547
Dnm2P390524EBI-346595,EBI-349613From a different organism.
Hip1rQ9JKY53EBI-346595,EBI-642457From a different organism.
INPP5DQ928356EBI-346595,EBI-1380477
MAP3K4Q9Y6R45EBI-346595,EBI-448104
SH3BP2P783148EBI-346595,EBI-727062
SH3GL2Q999622EBI-346595,EBI-77938
SPRY2O435972EBI-346595,EBI-742487
SQSTM1Q135014EBI-346595,EBI-307104
STAP1Q9ULZ24EBI-346595,EBI-6083058
SYNJ2O150563EBI-346595,EBI-310513
UBCP0CG486EBI-346595,EBI-3390054

Protein-protein interaction databases

BioGridi119029. 240 interactions.
DIPiDIP-31803N.
IntActiQ96B97. 42 interactions.
MINTiMINT-233697.
STRINGi9606.ENSP00000380921.

Structurei

Secondary structure

Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi4 – 85
Beta strandi25 – 306
Turni33 – 353
Beta strandi36 – 416
Beta strandi44 – 496
Helixi50 – 523
Beta strandi53 – 553
Beta strandi102 – 1054
Beta strandi113 – 1153
Beta strandi124 – 1263
Helixi130 – 1323
Beta strandi149 – 1535
Turni161 – 1644
Beta strandi270 – 2767
Beta strandi283 – 2853
Beta strandi293 – 2997
Beta strandi301 – 3033
Beta strandi306 – 3116
Beta strandi314 – 3196
Helixi320 – 3223
Beta strandi323 – 3253

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2BZ8X-ray2.00A/B1-58[»]
2K6DNMR-A267-328[»]
2K9GNMR-A262-333[»]
2O2ONMR-A92-168[»]
2YDLX-ray2.05A270-328[»]
ProteinModelPortaliQ96B97.
SMRiQ96B97. Positions 2-58, 92-182, 262-345.

Miscellaneous databases

EvolutionaryTraceiQ96B97.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini1 – 5858SH3 1
Add
BLAST
Domaini98 – 15760SH3 2
Add
BLAST
Domaini267 – 32862SH3 3
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili602 – 66463 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi327 – 428102Pro-rich
Add
BLAST

Domaini

The SH3 domains mediate interaction with SHKBP1 By similarity.

Sequence similaritiesi

Contains 3 SH3 domains.

Keywords - Domaini

Coiled coil, Repeat, SH3 domain, SH3-binding

Phylogenomic databases

eggNOGiNOG319250.
HOGENOMiHOG000231405.
HOVERGENiHBG057824.
InParanoidiQ96B97.
KOiK12470.
OMAiMDSRTKT.
OrthoDBiEOG7W41BC.
PhylomeDBiQ96B97.
TreeFamiTF350191.

Family and domain databases

InterProiIPR001452. SH3_domain.
[Graphical view]
PfamiPF14604. SH3_9. 3 hits.
[Graphical view]
PRINTSiPR00452. SH3DOMAIN.
SMARTiSM00326. SH3. 3 hits.
[Graphical view]
SUPFAMiSSF50044. SSF50044. 3 hits.
PROSITEiPS50002. SH3. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q96B97-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVEAIVEFDY QAQHDDELTI SVGEIITNIR KEDGGWWEGQ INGRRGLFPD    50
NFVREIKKEM KKDPLTNKAP EKPLHEVPSG NSLLSSETIL RTNKRGERRR 100
RRCQVAFSYL PQNDDELELK VGDIIEVVGE VEEGWWEGVL NGKTGMFPSN 150
FIKELSGESD ELGISQDEQL SKSSLRETTG SESDGGDSSS TKSEGANGTV 200
ATAAIQPKKV KGVGFGDIFK DKPIKLRPRS IEVENDFLPV EKTIGKKLPA 250
TTATPDSSKT EMDSRTKSKD YCKVIFPYEA QNDDELTIKE GDIVTLINKD 300
CIDVGWWEGE LNGRRGVFPD NFVKLLPPDF EKEGNRPKKP PPPSAPVIKQ 350
GAGTTERKHE IKKIPPERPE MLPNRTEEKE RPEREPKLDL QKPSVPAIPP 400
KKPRPPKTNS LSRPGALPPR RPERPVGPLT HTRGDSPKID LAGSSLSGIL 450
DKDLSDRSND IDLEGFDSVV SSTEKLSHPT TSRPKATGRR PPSQSLTSSS 500
LSSPDIFDSP SPEEDKEEHI SLAHRGVDAS KKTSKTVTIS QVSDNKASLP 550
PKPGTMAAGG GGPAPLSSAA PSPLSSSLGT AGHRANSPSL FGTEGKPKME 600
PAASSQAAVE ELRTQVRELR SIIETMKDQQ KREIKQLLSE LDEEKKIRLR 650
LQMEVNDIKK ALQSK 665

Note: Interacts with CBL.

Length:665
Mass (Da):73,126
Last modified:May 23, 2003 - v2
Checksum:i3BD350FCDB14BD4C
GO
Isoform 2 (identifier: Q96B97-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-54: MVEAIVEFDYQAQHDDELTISVGEIITNIRKEDGGWWEGQINGRRGLFPDNFVR → MEVSAAKAPSAADLSEI

Note: Interacts with CD2 cytoplasmic tail and does not interact with F-actin.

Show »
Length:628
Mass (Da):68,550
Checksum:i8AD93481480879D6
GO
Isoform 3 (identifier: Q96B97-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-4: MVEA → MGEE
     5-242: Missing.

Note: No experimental confirmation available.

Show »
Length:427
Mass (Da):46,610
Checksum:iCDD6AC2770E695F4
GO

Sequence cautioni

The sequence AAH50663.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti382 – 3821P → L.1 Publication
VAR_015667

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5454MVEAI…DNFVR → MEVSAAKAPSAADLSEI in isoform 2.
VSP_007504Add
BLAST
Alternative sequencei1 – 44MVEA → MGEE in isoform 3.
VSP_044655
Alternative sequencei5 – 242238Missing in isoform 3.
VSP_044656Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti288 – 2881I → T in BAH11471. 1 Publication
Sequence conflicti426 – 4261V → A in BAH11471. 1 Publication
Sequence conflicti570 – 5701A → V in AAH15806. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF230904 mRNA. Translation: AAF37854.1.
AF542051 mRNA. Translation: AAN77231.1.
AK293234 mRNA. Translation: BAH11470.1.
AK293237 mRNA. Translation: BAH11471.1.
AL732423, AL732325, AL732327 Genomic DNA. Translation: CAI40277.1.
AL732423, AL732327 Genomic DNA. Translation: CAI40278.1.
AL732327, AL732325, AL732423 Genomic DNA. Translation: CAI40511.1.
AL732327, AL732423 Genomic DNA. Translation: CAI40512.1.
AL732325, AL732327, AL732423 Genomic DNA. Translation: CAI41254.1.
AL732409 Genomic DNA. No translation available.
AL772197 Genomic DNA. No translation available.
BC015806 mRNA. Translation: AAH15806.1.
BC050663 mRNA. Translation: AAH50663.1. Sequence problems.
AF329267 mRNA. Translation: AAK95587.1.
AF329268 mRNA. Translation: AAO13348.1.
CCDSiCCDS14193.1. [Q96B97-1]
CCDS35213.1. [Q96B97-2]
CCDS55383.1. [Q96B97-3]
PIRiJC7191.
RefSeqiNP_001019837.1. NM_001024666.2. [Q96B97-2]
NP_001171889.1. NM_001184960.1. [Q96B97-3]
NP_114098.1. NM_031892.2. [Q96B97-1]
UniGeneiHs.726365.

Genome annotation databases

EnsembliENST00000379698; ENSP00000369020; ENSG00000147010. [Q96B97-2]
ENST00000379716; ENSP00000369039; ENSG00000147010. [Q96B97-3]
ENST00000397821; ENSP00000380921; ENSG00000147010. [Q96B97-1]
GeneIDi30011.
KEGGihsa:30011.
UCSCiuc004czl.3. human. [Q96B97-2]
uc004czm.3. human. [Q96B97-1]
uc011mjf.2. human.

Polymorphism databases

DMDMi31077034.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF230904 mRNA. Translation: AAF37854.1 .
AF542051 mRNA. Translation: AAN77231.1 .
AK293234 mRNA. Translation: BAH11470.1 .
AK293237 mRNA. Translation: BAH11471.1 .
AL732423 , AL732325 , AL732327 Genomic DNA. Translation: CAI40277.1 .
AL732423 , AL732327 Genomic DNA. Translation: CAI40278.1 .
AL732327 , AL732325 , AL732423 Genomic DNA. Translation: CAI40511.1 .
AL732327 , AL732423 Genomic DNA. Translation: CAI40512.1 .
AL732325 , AL732327 , AL732423 Genomic DNA. Translation: CAI41254.1 .
AL732409 Genomic DNA. No translation available.
AL772197 Genomic DNA. No translation available.
BC015806 mRNA. Translation: AAH15806.1 .
BC050663 mRNA. Translation: AAH50663.1 . Sequence problems.
AF329267 mRNA. Translation: AAK95587.1 .
AF329268 mRNA. Translation: AAO13348.1 .
CCDSi CCDS14193.1. [Q96B97-1 ]
CCDS35213.1. [Q96B97-2 ]
CCDS55383.1. [Q96B97-3 ]
PIRi JC7191.
RefSeqi NP_001019837.1. NM_001024666.2. [Q96B97-2 ]
NP_001171889.1. NM_001184960.1. [Q96B97-3 ]
NP_114098.1. NM_031892.2. [Q96B97-1 ]
UniGenei Hs.726365.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2BZ8 X-ray 2.00 A/B 1-58 [» ]
2K6D NMR - A 267-328 [» ]
2K9G NMR - A 262-333 [» ]
2O2O NMR - A 92-168 [» ]
2YDL X-ray 2.05 A 270-328 [» ]
ProteinModelPortali Q96B97.
SMRi Q96B97. Positions 2-58, 92-182, 262-345.
ModBasei Search...

Protein-protein interaction databases

BioGridi 119029. 240 interactions.
DIPi DIP-31803N.
IntActi Q96B97. 42 interactions.
MINTi MINT-233697.
STRINGi 9606.ENSP00000380921.

PTM databases

PhosphoSitei Q96B97.

Polymorphism databases

DMDMi 31077034.

Proteomic databases

MaxQBi Q96B97.
PaxDbi Q96B97.
PRIDEi Q96B97.

Protocols and materials databases

DNASUi 30011.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379698 ; ENSP00000369020 ; ENSG00000147010 . [Q96B97-2 ]
ENST00000379716 ; ENSP00000369039 ; ENSG00000147010 . [Q96B97-3 ]
ENST00000397821 ; ENSP00000380921 ; ENSG00000147010 . [Q96B97-1 ]
GeneIDi 30011.
KEGGi hsa:30011.
UCSCi uc004czl.3. human. [Q96B97-2 ]
uc004czm.3. human. [Q96B97-1 ]
uc011mjf.2. human.

Organism-specific databases

CTDi 30011.
GeneCardsi GC0XM019552.
HGNCi HGNC:13867. SH3KBP1.
HPAi CAB021892.
HPA003351.
HPA003355.
MIMi 300374. gene.
neXtProti NX_Q96B97.
PharmGKBi PA37822.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG319250.
HOGENOMi HOG000231405.
HOVERGENi HBG057824.
InParanoidi Q96B97.
KOi K12470.
OMAi MDSRTKT.
OrthoDBi EOG7W41BC.
PhylomeDBi Q96B97.
TreeFami TF350191.

Enzyme and pathway databases

Reactomei REACT_118700. Antigen activates B Cell Receptor (BCR) leading to generation of second messengers.
REACT_12484. EGFR downregulation.
SignaLinki Q96B97.

Miscellaneous databases

ChiTaRSi SH3KBP1. human.
EvolutionaryTracei Q96B97.
GeneWikii SH3KBP1.
GenomeRNAii 30011.
NextBioi 52832.
PROi Q96B97.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q96B97.
Bgeei Q96B97.
CleanExi HS_SH3KBP1.
Genevestigatori Q96B97.

Family and domain databases

InterProi IPR001452. SH3_domain.
[Graphical view ]
Pfami PF14604. SH3_9. 3 hits.
[Graphical view ]
PRINTSi PR00452. SH3DOMAIN.
SMARTi SM00326. SH3. 3 hits.
[Graphical view ]
SUPFAMi SSF50044. SSF50044. 3 hits.
PROSITEi PS50002. SH3. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and characterization of a novel adaptor protein, CIN85, that interacts with c-Cbl."
    Take H., Watanabe S., Takeda K., Yu Z.-X., Iwata N., Kajigaya S.
    Biochem. Biophys. Res. Commun. 268:321-328(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH CBL.
  2. "CD2BP3, CIN85 and the structurally related adaptor protein CMS bind to the same CD2 cytoplasmic segment but elicit divergent functional activities."
    Tibaldi E.V., Reinherz E.L.
    Int. Immunol. 15:313-329(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
    Tissue: T-cell.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 2 AND 3).
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adrenal cortex and Uterus.
  6. "Assignment of SH3KBP1 to human chromosome band Xp22.1-->p21.3 by in situ hybridization."
    Narita T., Amano F., Yoshizaki K., Nishimoto N., Nishimura T., Tajima T., Namiki H., Taniyama T.
    Cytogenet. Cell Genet. 93:133-134(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 262-665, VARIANT LEU-382.
  7. "Characterization of the CIN85 adaptor protein and identification of components involved in CIN85 complexes."
    Watanabe S., Take H., Takeda K., Yu Z.X., Iwata N., Kajigaya S.
    Biochem. Biophys. Res. Commun. 278:167-174(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH BLNK; CRK; BCAR1; PIK3R3; GRB2 AND SOS1, SELF-ASSOCIATION.
  8. "CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases."
    Szymkiewicz I., Kowanetz K., Soubeyran P., Dinarina A., Lipkowitz S., Dikic I.
    J. Biol. Chem. 277:39666-39672(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CBLB AND ENDOPHILINS, LACK OF INTERACTION WITH CBLC, FUNCTION IN RECEPTOR INTERNALIZATION, SUBCELLULAR LOCATION.
  9. "Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors."
    Soubeyran P., Kowanetz K., Szymkiewicz I., Langdon W.Y., Dikic I.
    Nature 416:183-187(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH EGFR; SH3GL1; SH3GL2; SH3GL3 AND CBL, SUBCELLULAR LOCATION.
  10. "The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met."
    Petrelli A., Gilestro G.F., Lanzardo S., Comoglio P.M., Migone N., Giordano S.
    Nature 416:187-190(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH SH3GL1; SH3GL2; SH3GL3; CBL AND MET.
  11. "Cbl-directed monoubiquitination of CIN85 is involved in regulation of ligand-induced degradation of EGF receptors."
    Haglund K., Shimokawa N., Szymkiewicz I., Dikic I.
    Proc. Natl. Acad. Sci. U.S.A. 99:12191-12196(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION BY CBL AND CBLB.
  12. "Dab2 links CIN85 with clathrin-mediated receptor internalization."
    Kowanetz K., Terzic J., Dikic I.
    FEBS Lett. 554:81-87(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DAB2, IDENTIFICATION IN A COMPLEX WITH DAB2 AND CLATHRIN.
  13. "SETA/CIN85/Ruk and its binding partner AIP1 associate with diverse cytoskeletal elements, including FAKs, and modulate cell adhesion."
    Schmidt M.H., Chen B., Randazzo L.M., Boegler O.
    J. Cell Sci. 116:2845-2855(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN CELL ADHESION, INTERACTION WITH PDCD6IP; PTK2/FAK1 AND PTK2B/PYK2.
  14. "Linking the T cell surface protein CD2 to the actin-capping protein CAPZ via CMS and CIN85."
    Hutchings N.J., Clarkson N., Chalkley R., Barclay A.N., Brown M.H.
    J. Biol. Chem. 278:22396-22403(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH CD2 AND F-ACTIN CAPPING PROTEIN.
  15. "Epidermal growth factor receptor signaling intensity determines intracellular protein interactions, ubiquitination, and internalization."
    Schmidt M.H., Furnari F.B., Cavenee W.K., Bogler O.
    Proc. Natl. Acad. Sci. U.S.A. 100:6505-6510(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN RECEPTOR INTERNALIZATION.
  16. "Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry."
    Brill L.M., Salomon A.R., Ficarro S.B., Mukherji M., Stettler-Gill M., Peters E.C.
    Anal. Chem. 76:2763-2772(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  17. "CIN85 associates with multiple effectors controlling intracellular trafficking of epidermal growth factor receptors."
    Kowanetz K., Husnjak K., Holler D., Kowanetz M., Soubeyran P., Hirsch D., Schmidt M.H., Pavelic K., De Camilli P., Randazzo P.A., Dikic I.
    Mol. Biol. Cell 15:3155-3166(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN RECEPTOR INTERNALIZATION, INTERACTION WITH ASAP1; ARAP3; HIP1R; SYNJ2; INPP5D; STAP1 AND EGFR, IDENTIFICATION IN A COMPLEX WITH ASAP1 AND ARAP3, SUBCELLULAR LOCATION.
  18. "Alix/AIP1 antagonizes epidermal growth factor receptor downregulation by the Cbl-SETA/CIN85 complex."
    Schmidt M.H., Hoeller D., Yu J., Furnari F.B., Cavenee W.K., Dikic I., Bogler O.
    Mol. Cell. Biol. 24:8981-8993(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH PDCD6IP; EGFR; CBL AND CBLB.
  19. "CIN85 regulates the ability of MEKK4 to activate the p38 MAP kinase pathway."
    Aissouni Y., Zapart G., Iovanna J.L., Dikic I., Soubeyran P.
    Biochem. Biophys. Res. Commun. 338:808-814(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MAP3K4.
  20. "Sprouty2 acts at the Cbl/CIN85 interface to inhibit epidermal growth factor receptor downregulation."
    Haglund K., Schmidt M.H., Wong E.S., Guy G.R., Dikic I.
    EMBO Rep. 6:635-641(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH SPRY2.
  21. "CIN85 associates with TNF receptor 1 via Src and modulates TNF-alpha-induced apoptosis."
    Narita T., Nishimura T., Yoshizaki K., Taniyama T.
    Exp. Cell Res. 304:256-264(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN APOPTOSIS, INTERACTION WITH SRC; LCK; LYN; FGR; FYN; HCK; TRADD; BIRC2; TRAF1; TRAF2 AND TNFR1.
  22. "CIN85 regulates the ligand-dependent endocytosis of the IgE receptor: a new molecular mechanism to dampen mast cell function."
    Molfetta R., Belleudi F., Peruzzi G., Morrone S., Leone L., Dikic I., Piccoli M., Frati L., Torrisi M.R., Santoni A., Paolini R.
    J. Immunol. 175:4208-4216(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN RECEPTOR INTERNALIZATION.
  23. "A Rich1/Amot complex regulates the Cdc42 GTPase and apical-polarity proteins in epithelial cells."
    Wells C.D., Fawcett J.P., Traweger A., Yamanaka Y., Goudreault M., Elder K., Kulkarni S., Gish G., Virag C., Lim C., Colwill K., Starostine A., Metalnikov P., Pawson T.
    Cell 125:535-548(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH ARHGAP17.
  24. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  25. "CIN85 is localized at synapses and forms a complex with S-SCAM via dendrin."
    Kawata A., Iida J., Ikeda M., Sato Y., Mori H., Kansaku A., Sumita K., Fujiwara N., Rokukawa C., Hamano M., Hirabayashi S., Hata Y.
    J. Biochem. 139:931-939(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH DDN AND MAGI2, SUBCELLULAR LOCATION.
  26. "CFBP is a novel tyrosine-phosphorylated protein that might function as a regulator of CIN85/CD2AP."
    Konishi H., Tashiro K., Murata Y., Nabeshi H., Yamauchi E., Taniguchi H.
    J. Biol. Chem. 281:28919-28931(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MVB12A.
  27. "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment."
    Carrascal M., Ovelleiro D., Casas V., Gay M., Abian J.
    J. Proteome Res. 7:5167-5176(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: T-cell.
  28. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-254; SER-436; SER-509; SER-511; SER-521 AND SER-587, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  29. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  30. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230; SER-436 AND SER-587, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  31. "Identification and characterization of a set of conserved and new regulators of cytoskeletal organisation, cell morphology and migration."
    Bai S.W., Herrera-Abreu M.T., Rohn J.L., Racine V., Tajadura V., Suryavanshi N., Bechtel S., Wiemann S., Baum B., Ridley A.J.
    BMC Biol. 9:54-54(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  32. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  33. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-230, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  34. Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 1-58 IN COMPLEX WITH CBLB.

Entry informationi

Entry nameiSH3K1_HUMAN
AccessioniPrimary (citable) accession number: Q96B97
Secondary accession number(s): B7Z1D5
, Q5JPT4, Q5JPT5, Q8IWX6, Q8IX98, Q96RN4, Q9NYR0
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 23, 2003
Last sequence update: May 23, 2003
Last modified: September 3, 2014
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi